| Clone Name | baet97h08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MTK1_KLEPN (P25238) Modification methylase KpnI (EC 2.1.1.72) (A... | 28 | 4.3 | 2 | DNJ15_ARATH (Q9ZSY2) Chaperone protein dnaJ 15 (Protein ALTERED ... | 28 | 5.7 |
|---|
>MTK1_KLEPN (P25238) Modification methylase KpnI (EC 2.1.1.72)| (Adenine-specific methyltransferase KpnI) (M.KpnI) Length = 417 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 198 CKQATGTGSERKLSSFASSTLVFGP*LLVEMSKMTDEK 311 C+ G GS+R ++S LV+G + E+S D+K Sbjct: 149 CRSKNGKGSKRNIASAHEYLLVYGKSDMAELSGQPDDK 186
>DNJ15_ARATH (Q9ZSY2) Chaperone protein dnaJ 15 (Protein ALTERED RESPONSE TO| GRAVITY) (AtARG1) (AtJ15) (AtDjB15) Length = 410 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +1 Query: 88 DNLAN*NILVARGKESKSDSRSSGERNGSSLNRE 189 +NL+N + A+G ESK D S+GE G+ NR+ Sbjct: 359 NNLSNGSSSKAQGDESKGDGDSAGEEGGTE-NRD 391 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,747,607 Number of Sequences: 219361 Number of extensions: 585910 Number of successful extensions: 1428 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1428 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)