| Clone Name | baet97g08 |
|---|---|
| Clone Library Name | barley_pub |
>TIP41_ORYSA (Q75GA5) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (OsTIP4.1) Length = 251 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 132 KHADSFDEREVAVVDTGCVRTVLGELV 212 K D D EV VD GCVR VL ELV Sbjct: 3 KEVDPCDHGEV--VDAGCVRAVLAELV 27
>VGLX_EHV1V (Q6S6W0) Glycoprotein X precursor| Length = 866 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -2 Query: 211 TSSPSTVRTQPVSTTATSRSSNESACLVAAMAGLNST 101 TSSPS+ TQ ST ATS S+ +A ++ ST Sbjct: 70 TSSPSSTSTQSSSTAATSSSAPSTASSTTSIPTSTST 106
>VGLX_EHV1B (P28968) Glycoprotein X precursor| Length = 797 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -2 Query: 211 TSSPSTVRTQPVSTTATSRSSNESACLVAAMAGLNST 101 TSSPS+ TQ ST ATS S+ +A ++ ST Sbjct: 70 TSSPSSTSTQSSSTAATSSSAPSTASSTTSIPTSTST 106
>HGD_XANCP (Q8PDA2) Homogentisate 1,2-dioxygenase (EC 1.13.11.5)| (Homogentisicase) (Homogentisate oxygenase) (Homogentisic acid oxidase) Length = 455 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +2 Query: 20 FGALLHRPELSPLFLPSF-HPKNKSDECGGVQSRHGRHQ 133 FG LLH P+L P+ +P++ C + R GR + Sbjct: 222 FGGLLHLPDLGPIGSNGLANPRDFETPCAAFEQREGRFE 260
>HGD_XANC8 (Q4UZI9) Homogentisate 1,2-dioxygenase (EC 1.13.11.5)| (Homogentisicase) (Homogentisate oxygenase) (Homogentisic acid oxidase) Length = 455 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +2 Query: 20 FGALLHRPELSPLFLPSF-HPKNKSDECGGVQSRHGRHQ 133 FG LLH P+L P+ +P++ C + R GR + Sbjct: 222 FGGLLHLPDLGPIGSNGLANPRDFETPCAAFEQREGRFE 260
>SMAD3_RAT (P84025) Mothers against decapentaplegic homolog 3 (SMAD 3)| (Mothers against DPP homolog 3) (Mad3) Length = 425 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 108 TPPHSSLLFLGWKEGRKRGESSGRCKSAPKS 16 TPP L LGWK+G + G+ C+ A KS Sbjct: 8 TPPIVKRL-LGWKKGEQNGQEEKWCEKAVKS 37
>SMAD3_PIG (P84024) Mothers against decapentaplegic homolog 3 (SMAD 3)| (Mothers against DPP homolog 3) (Mad3) Length = 425 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 108 TPPHSSLLFLGWKEGRKRGESSGRCKSAPKS 16 TPP L LGWK+G + G+ C+ A KS Sbjct: 8 TPPIVKRL-LGWKKGEQNGQEEKWCEKAVKS 37
>SMAD3_MOUSE (Q8BUN5) Mothers against decapentaplegic homolog 3 (SMAD 3)| (Mothers against DPP homolog 3) (Mad3) (mMad3) Length = 425 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 108 TPPHSSLLFLGWKEGRKRGESSGRCKSAPKS 16 TPP L LGWK+G + G+ C+ A KS Sbjct: 8 TPPIVKRL-LGWKKGEQNGQEEKWCEKAVKS 37
>SMAD3_HUMAN (P84022) Mothers against decapentaplegic homolog 3 (SMAD 3)| (Mothers against DPP homolog 3) (Mad3) (hMAD-3) (JV15-2) (hSMAD3) Length = 425 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 108 TPPHSSLLFLGWKEGRKRGESSGRCKSAPKS 16 TPP L LGWK+G + G+ C+ A KS Sbjct: 8 TPPIVKRL-LGWKKGEQNGQEEKWCEKAVKS 37
>SMAD3_CHICK (P84023) Mothers against decapentaplegic homolog 3 (SMAD 3)| (Mothers against DPP homolog 3) (Mad3) Length = 426 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 108 TPPHSSLLFLGWKEGRKRGESSGRCKSAPKS 16 TPP L LGWK+G + G+ C+ A KS Sbjct: 8 TPPIVKRL-LGWKKGEQNGQEEKWCEKAVKS 37
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 199 STVRTQPVSTTATSRSSNESACLVAAMAGLNSTT 98 S + V+TTA SRS+ A +VA GL S + Sbjct: 4 SMLSNAAVATTAASRSAGAQASMVAPFTGLKSVS 37 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,885,519 Number of Sequences: 219361 Number of extensions: 283290 Number of successful extensions: 1178 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1176 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)