| Clone Name | baet97g04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 p... | 44 | 9e-05 | 2 | FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 pre... | 41 | 0.001 | 3 | FLA1_ARATH (Q9FM65) Fasciclin-like arabinogalactan protein 1 pre... | 38 | 0.006 | 4 | MBB1_CHLRE (Q9FNS4) PsbB mRNA maturation factor Mbb1, chloroplas... | 29 | 3.8 |
|---|
>FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 precursor| Length = 422 Score = 44.3 bits (103), Expect = 9e-05 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = +2 Query: 131 GYNITKILGEYPEYSQFNKLLTQTRLAQDIN 223 G+NIT+IL + PEYS FN L+QT+LA +IN Sbjct: 25 GHNITQILSDTPEYSSFNNYLSQTKLADEIN 55
>FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 precursor| (AtAGP8) Length = 420 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/30 (56%), Positives = 24/30 (80%) Frame = +2 Query: 134 YNITKILGEYPEYSQFNKLLTQTRLAQDIN 223 +NIT+IL + P+YS FN L+QT+LA +IN Sbjct: 26 HNITQILADSPDYSSFNSYLSQTKLADEIN 55
>FLA1_ARATH (Q9FM65) Fasciclin-like arabinogalactan protein 1 precursor| Length = 424 Score = 38.1 bits (87), Expect = 0.006 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = +2 Query: 134 YNITKILGEYPEYSQFNKLLTQTRLAQDINK 226 +N+T++L +P +S F+ LTQT LA +IN+ Sbjct: 25 HNVTRLLANHPSFSSFSHFLTQTHLADEINR 55
>MBB1_CHLRE (Q9FNS4) PsbB mRNA maturation factor Mbb1, chloroplast precursor| Length = 662 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -1 Query: 174 EYSGYSPRILVMLYPSAARRRASIV--LLVLGASAPGARDGAGRTG 43 + + Y P ++ L PSA RR++ V ++ S+ G+ DG G G Sbjct: 47 QVAAYEPTAVLQLAPSAVSRRSTPVRSSIIADLSSSGSGDGEGERG 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,510,947 Number of Sequences: 219361 Number of extensions: 178611 Number of successful extensions: 816 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)