| Clone Name | baet97f11 |
|---|---|
| Clone Library Name | barley_pub |
>MASY_MAIZE (P49081) Malate synthase, glyoxysomal (EC 2.3.3.9)| Length = 559 Score = 29.6 bits (65), Expect = 2.9 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -3 Query: 175 WLAGWLA---SVPPCTEGSRAACLPVSAAHRWGWTRHTYAFTVLGV 47 +LA WLA SVP AA +S W W RH A GV Sbjct: 440 YLAAWLAGSGSVPLYNLMEDAATAEISRVQNWQWLRHGAALDAGGV 485
>PSTA_MYCLE (Q50097) Phosphate transport system permease protein pstA| Length = 304 Score = 29.3 bits (64), Expect = 3.8 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Frame = +3 Query: 306 LGYQ---YLVNHFLTLLLVPVMAATALELARLGPDEL 407 LG+Q + V+ L LL++PV+ + E+ RL PDEL Sbjct: 149 LGFQQSAFAVSLALVLLMLPVVVRSTEEILRLVPDEL 185
>NU3C_SYNY3 (P19045) NAD(P)H-quinone oxidoreductase chain 3 (EC 1.6.5.-)| (NAD(P)H dehydrogenase I, chain 3) (NDH-1, chain 3) Length = 120 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 297 YVKLGYQYLVNHFLTLLLVPVMAATALELAR 389 +V GY+Y + LVPV+A TA +L R Sbjct: 2 FVLTGYEYFLGFLFICSLVPVLALTASKLLR 32
>CATB_RAT (P00787) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) (RSG-2)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 28.1 bits (61), Expect = 8.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 61 TVLGVGCGAGCDAGMPGGA 5 T G+ CG GC+ G P GA Sbjct: 140 TCCGIQCGDGCNGGYPSGA 158
>CATB_MOUSE (P10605) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 28.1 bits (61), Expect = 8.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 61 TVLGVGCGAGCDAGMPGGA 5 T G+ CG GC+ G P GA Sbjct: 140 TCCGIQCGDGCNGGYPSGA 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,687,420 Number of Sequences: 219361 Number of extensions: 684580 Number of successful extensions: 3082 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3078 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)