| Clone Name | baet97e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OBSCN_HUMAN (Q5VST9) Obscurin (Obscurin-myosin light chain kinas... | 33 | 0.21 | 2 | F10C1_HUMAN (Q70Z53) Protein FRA10AC1 | 30 | 2.4 | 3 | F10C1_RAT (Q5FVF1) Protein FRA10AC1 homolog | 28 | 5.3 | 4 | F10C1_MOUSE (Q8BP78) Protein FRA10AC1 homolog | 28 | 5.3 |
|---|
>OBSCN_HUMAN (Q5VST9) Obscurin (Obscurin-myosin light chain kinase)| (Obscurin-MLCK) (Obscurin-RhoGEF) Length = 7968 Score = 33.1 bits (74), Expect = 0.21 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 110 GDPVRRGHRICWFVAPDLDLDWKGRKQ 30 G+P+R+GH I W AP + WKG + Sbjct: 5894 GEPIRQGHFIVWEGAPGARMPWKGHNR 5920
>F10C1_HUMAN (Q70Z53) Protein FRA10AC1| Length = 315 Score = 29.6 bits (65), Expect = 2.4 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = -1 Query: 149 LVLGGQGQDVKEWG-------DPVRRGHRICWFVAPDLDLDWKGR 36 L GG+ +D K G D +R HR W ++D+ W+ R Sbjct: 86 LYYGGKKEDFKRLGENDKTDLDVIRENHRFLWNEEDEMDMTWEKR 130
>F10C1_RAT (Q5FVF1) Protein FRA10AC1 homolog| Length = 315 Score = 28.5 bits (62), Expect = 5.3 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 7/45 (15%) Frame = -1 Query: 149 LVLGGQGQDVKEWG-------DPVRRGHRICWFVAPDLDLDWKGR 36 L GG+ +D K G D +R HR W + D+ W+ R Sbjct: 86 LYYGGKREDFKRLGENDKTDLDVIRENHRFLWNEEDEADMTWEKR 130
>F10C1_MOUSE (Q8BP78) Protein FRA10AC1 homolog| Length = 315 Score = 28.5 bits (62), Expect = 5.3 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 7/45 (15%) Frame = -1 Query: 149 LVLGGQGQDVKEWG-------DPVRRGHRICWFVAPDLDLDWKGR 36 L GG+ +D K G D +R HR W + D+ W+ R Sbjct: 86 LYYGGKREDFKRLGENDKTDLDVIRENHRFLWNEEDEADMTWEKR 130 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,019,156 Number of Sequences: 219361 Number of extensions: 316427 Number of successful extensions: 1244 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1244 length of database: 80,573,946 effective HSP length: 27 effective length of database: 74,651,199 effective search space used: 1791628776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)