| Clone Name | baet97c12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COX42_RAT (Q91Y94) Cytochrome c oxidase subunit 4 isoform 2, mit... | 29 | 3.7 |
|---|
>COX42_RAT (Q91Y94) Cytochrome c oxidase subunit 4 isoform 2, mitochondrial| precursor (EC 1.9.3.1) (Cytochrome c oxidase subunit IV isoform 2) (COX IV-2) Length = 172 Score = 28.9 bits (63), Expect = 3.7 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -3 Query: 136 RGTHRGGAAASTSPWRMDSAVVCYDCIHERSY 41 +GTH G+AAS+S RM V DC +RSY Sbjct: 19 QGTHSPGSAASSSQRRMTPYV---DCYAQRSY 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,702,663 Number of Sequences: 219361 Number of extensions: 223977 Number of successful extensions: 528 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)