| Clone Name | baet97c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GDA1_ASPFU (Q8TGG8) Probable guanosine-diphosphatase (EC 3.6.1.4... | 28 | 4.4 | 2 | IFNG_TURTR (Q9TV67) Interferon gamma precursor (IFN-gamma) | 28 | 4.4 | 3 | KINH_NEUCR (P48467) Kinesin heavy chain | 27 | 9.8 |
|---|
>GDA1_ASPFU (Q8TGG8) Probable guanosine-diphosphatase (EC 3.6.1.42) (GDPase)| Length = 503 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 178 QEPRRVSNGAIIAAMLLSLCVLSIVKARYCSTPFGKP 288 Q R + GAI+AA+LL L +S + + S P G+P Sbjct: 5 QRSRYLKTGAIVAALLLMLLWISPSRPMHPSFPQGQP 41
>IFNG_TURTR (Q9TV67) Interferon gamma precursor (IFN-gamma)| Length = 166 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 220 MLLSLCVLSIVKARYCSTPFGKPDDQLKEQMNSS 321 + LCV+ YC PF K LKE N+S Sbjct: 8 LAFQLCVILGSSGSYCQAPFFKEIQNLKEYFNAS 41
>KINH_NEUCR (P48467) Kinesin heavy chain| Length = 928 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 13 EKSLPPWEEAGRQQAKPSKQARELTPCRLLPQ 108 EK +PP E A S AR TP RLLP+ Sbjct: 382 EKWVPPLELAITPSKSASTTARPSTPSRLLPE 413 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,939,403 Number of Sequences: 219361 Number of extensions: 309444 Number of successful extensions: 1004 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1004 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)