| Clone Name | baet97a09 |
|---|---|
| Clone Library Name | barley_pub |
>DVL2_HUMAN (O14641) Segment polarity protein dishevelled homolog DVL-2| (Dishevelled-2) (DSH homolog 2) Length = 736 Score = 29.6 bits (65), Expect = 2.9 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 3 KKESPRRRTSSERGAGHHALPEP 71 ++E PRRR SSE GAG H P Sbjct: 160 RRERPRRRDSSEHGAGGHRTGGP 182
>TTRAP_MOUSE (Q9JJX7) TRAF and TNF receptor-associated protein| Length = 370 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 142 ALQHQHQLDETQQSWLLGPPEAKKKDRYVDL 234 AL +L E Q W PP + K + YVDL Sbjct: 68 ALSAYFELPENDQGWPRQPPTSFKSEAYVDL 98
>IRS1_CERAE (Q28224) Insulin receptor substrate 1 (IRS-1)| Length = 1251 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 148 QHQHQLDETQQSWLLGPPEAKKKDRYVDL 234 Q Q Q + QQ LL PPE K YV++ Sbjct: 880 QQQQQQQQQQQQPLLHPPEPKSPGEYVNI 908
>EAF7_DEBHA (Q6BKL0) Chromatin modification-related protein EAF7| Length = 323 Score = 28.1 bits (61), Expect = 8.6 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 8/53 (15%) Frame = +1 Query: 88 DIDGAEDDQSRNMD--------IDRGALQHQHQLDETQQSWLLGPPEAKKKDR 222 D D +DD N + RGA +HQH+L + G P+ KK+ R Sbjct: 197 DDDDQDDDDDENESGEGSLQKRVTRGARKHQHELSDQ-----TGTPKPKKRTR 244
>DVL2_MOUSE (Q60838) Segment polarity protein dishevelled homolog DVL-2| (Dishevelled-2) (DSH homolog 2) Length = 736 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 3 KKESPRRRTSSERGAGHH 56 +++ PRRR SSE GAG H Sbjct: 160 RRDRPRRRDSSEHGAGGH 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,207,763 Number of Sequences: 219361 Number of extensions: 551881 Number of successful extensions: 2009 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2009 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)