| Clone Name | baet97a02 |
|---|---|
| Clone Library Name | barley_pub |
>CWC27_EMENI (Q5AUG9) Peptidyl-prolyl isomerase cwc27 (EC 5.2.1.8)| Length = 558 Score = 30.8 bits (68), Expect = 1.1 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +1 Query: 4 PSQTAPYKTRTRTQNLFPRSKPLFLPSPNGQEKPPSPP 117 P +AP K R +T +K L LP+P E+ PSPP Sbjct: 283 PQPSAPPKNRPKTPE---PTKQLPLPNPESPERSPSPP 317
>MEGF9_HUMAN (Q9H1U4) Multiple epidermal growth factor-like domains 9 precursor| (EGF-like domain-containing protein 5) (Multiple EGF-like domain protein 5) Length = 600 Score = 28.5 bits (62), Expect = 5.4 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 16 APYKTRTRTQNLFPRSKPLFLPSPNGQEKPPSPP 117 AP RT T +L S LP+P E P SPP Sbjct: 164 APTTPRTPTPDLPSSSNSSVLPTPPATEAPSSPP 197
>PLSB_XANCP (Q8P3E3) Glycerol-3-phosphate acyltransferase (EC 2.3.1.15) (GPAT)| Length = 886 Score = 28.5 bits (62), Expect = 5.4 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 55 PRSKPLFLPSPNGQEKPPSPPGA 123 P PL P P+GQ PPSP GA Sbjct: 2 PEQNPL--PFPDGQSAPPSPAGA 22
>BCOR_HUMAN (Q6W2J9) BCoR protein (BCL-6 corepressor)| Length = 1755 Score = 28.5 bits (62), Expect = 5.4 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 32 GHVRKTFFQDLNPSSSPPQMAKRS 103 GH RKT QD SSPP + K++ Sbjct: 408 GHARKTAVQDRKDGSSPPLLEKQT 431
>RAD52_DEBHA (Q6BJ51) DNA repair and recombination protein RAD52| Length = 573 Score = 28.1 bits (61), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 4 PSQTAPYKTRTRTQNLFPRSKPLFLPSPNGQEKP 105 PSQ PYK R + +L RSKP P+ + P Sbjct: 508 PSQKPPYKRRHQDASLSQRSKPDETSQPSSKAVP 541
>ROUGH_DROME (P10181) Homeobox protein rough| Length = 350 Score = 28.1 bits (61), Expect = 7.1 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 8 HKQHHTRHGHVRKTFFQDLNPSSSPPQMA 94 H+QHH H H + Q L+ S PP +A Sbjct: 122 HQQHHHHHHHPPQLVHQKLSYVSPPPAIA 150
>GP10_DICDI (Q06885) Glycoprotein gp100 precursor (P29F8)| Length = 544 Score = 28.1 bits (61), Expect = 7.1 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 1 TPSQTAP--YKTRTRTQNLFPRSKPLFLPSPNGQEKPPSPP 117 TPSQT P Q P SKP P+P P S P Sbjct: 135 TPSQTIPPTVSPTVPPQTTSPTSKPTSTPTPTSTPTPTSTP 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.307 0.129 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,574,580 Number of Sequences: 219361 Number of extensions: 334026 Number of successful extensions: 2151 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2124 length of database: 80,573,946 effective HSP length: 17 effective length of database: 76,844,809 effective search space used: 1844275416 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)