| Clone Name | baet96h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COA2_POVLY (P04011) Coat protein VP2 [Contains: Coat protein VP3] | 29 | 5.8 |
|---|
>COA2_POVLY (P04011) Coat protein VP2 [Contains: Coat protein VP3]| Length = 355 Score = 29.3 bits (64), Expect = 5.8 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 165 AELPIHRSTGAVMAHQIPKVAHTLVEIAEVARYA 266 A L I ++T AV +++HTL +IAE AR+A Sbjct: 168 ATLQIGQATRAVAVRSTNELSHTLAQIAENARWA 201 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,693,895 Number of Sequences: 219361 Number of extensions: 470784 Number of successful extensions: 1739 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1733 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)