| Clone Name | baet96g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PYRC_SYNY3 (P74438) Dihydroorotase (EC 3.5.2.3) (DHOase) | 30 | 2.3 | 2 | CNTN5_BRARE (Q7ZW34) Contactin-5 precursor | 29 | 3.0 | 3 | GUN6_DICDI (P22699) Endoglucanase precursor (EC 3.2.1.4) (Endo-1... | 29 | 4.0 |
|---|
>PYRC_SYNY3 (P74438) Dihydroorotase (EC 3.5.2.3) (DHOase)| Length = 342 Score = 29.6 bits (65), Expect = 2.3 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +3 Query: 3 AVRTLDHDPYLSSSHGVDNHSTQQEPSQIESSALPWRLNSTMPSP---ILPAKEVEEV 167 +V +LD +S +G D + + +QI PWR+ + +P P ++P + EE+ Sbjct: 280 SVNSLDKLEAFASFYGPDFYQLPRNTAQITLMKNPWRIPAELPFPESGLVPLRAGEEI 337
>CNTN5_BRARE (Q7ZW34) Contactin-5 precursor| Length = 1056 Score = 29.3 bits (64), Expect = 3.0 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 33 LSSSHGVDNHS--TQQEPSQIESSALPWRLNSTMPSPILPAKE 155 LS SHGVDNHS T +L W+ T P P+ + E Sbjct: 645 LSWSHGVDNHSPITTYNVQARSPVSLGWQTVKTDPDPVTGSME 687
>GUN6_DICDI (P22699) Endoglucanase precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase) (Spore germination protein 270-6) (Cellulase) Length = 705 Score = 28.9 bits (63), Expect = 4.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 166 TSSTSFAGKIGDGMVELSLQGKAEDSIWLGSCWVL*LSTP*EEL 35 T+ FAG++GDG V+ S G ED ++L P E+ Sbjct: 136 TADNEFAGQVGDGNVDHSWWGPPEDMTMARPTYMLTTEAPGTEI 179 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,203,193 Number of Sequences: 219361 Number of extensions: 354843 Number of successful extensions: 1218 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1218 length of database: 80,573,946 effective HSP length: 33 effective length of database: 73,335,033 effective search space used: 1760040792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)