| Clone Name | baet96g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLS_SINDV (P03316) Structural polyprotein (p130) [Contains: Cap... | 28 | 8.4 | 2 | IDLC_STRPU (Q26630) 33 kDa inner dynein arm light chain, axonema... | 28 | 8.4 |
|---|
>POLS_SINDV (P03316) Structural polyprotein (p130) [Contains: Capsid protein (EC| 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike g Length = 1245 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +3 Query: 66 GGAWPFLVGGAICLVNSVNERDLSLLTSYAEPTAAPHVK 182 GG +PF+ GGA C +S N + + A+ H + Sbjct: 888 GGVYPFMWGGAQCFCDSENSQMSEAYVELSADCASDHAQ 926
>IDLC_STRPU (Q26630) 33 kDa inner dynein arm light chain, axonemal (p33)| Length = 260 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 6/34 (17%) Frame = -1 Query: 94 PPTKNGHAPPPIESRKSSQ------SVNPCYVWT 11 PP K G PP+ES+K+ Q S+ P WT Sbjct: 47 PPPKGGSKLPPVESQKAQQTDEILNSILPPREWT 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,132,302 Number of Sequences: 219361 Number of extensions: 480848 Number of successful extensions: 1183 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1183 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)