| Clone Name | baet96f02 |
|---|---|
| Clone Library Name | barley_pub |
>GTR8_RAT (Q9JJZ1) Solute carrier family 2, facilitated glucose transporter| member 8 (Glucose transporter type 8) (Glucose transporter type X1) Length = 478 Score = 35.8 bits (81), Expect = 0.055 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +3 Query: 297 FLCTMIVALGPIQFGFTGGFSSPTQDAIIRD----LNLSISEFSVFGSLST 437 FL T ALGP+ FGF G+SSP ++ R L L + S FG++ T Sbjct: 27 FLATFAAALGPLSFGFALGYSSPAIPSLRRTAPPALRLGDTAASWFGAVVT 77
>GTR8_MOUSE (Q9JIF3) Solute carrier family 2, facilitated glucose transporter| member 8 (Glucose transporter type 8) (Glucose transporter type X1) Length = 477 Score = 34.3 bits (77), Expect = 0.16 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +3 Query: 297 FLCTMIVALGPIQFGFTGGFSSPTQDAIIRD----LNLSISEFSVFGSLST 437 FL + ALGP+ FGF G+SSP ++ R L L + S FG++ T Sbjct: 27 FLASFAAALGPLSFGFALGYSSPAIPSLRRTAPPALRLGDNAASWFGAVVT 77
>GTR6_HUMAN (Q9UGQ3) Solute carrier family 2, facilitated glucose transporter| member 6 (Glucose transporter type 6) (Glucose transporter type 9) Length = 507 Score = 32.3 bits (72), Expect = 0.61 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +3 Query: 297 FLCTMIVALGPIQFGFTGGFSSPTQDAIIR----DLNLSISEFSVFGSLST 437 FL T LG FG+ ++SP A+ R DL+L+ S+ S FGS+ T Sbjct: 39 FLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQASWFGSVFT 89
>GTR8_HUMAN (Q9NY64) Solute carrier family 2, facilitated glucose transporter| member 8 (Glucose transporter type 8) (Glucose transporter type X1) Length = 477 Score = 32.0 bits (71), Expect = 0.79 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 297 FLCTMIVALGPIQFGFTGGFSSPTQDAIIR 386 FL ALGP+ FGF G+SSP ++ R Sbjct: 27 FLAAFAAALGPLSFGFALGYSSPAIPSLQR 56
>GTR8_BOVIN (P58354) Solute carrier family 2, facilitated glucose transporter| member 8 (Glucose transporter type 8) (Glucose transporter type X1) Length = 478 Score = 32.0 bits (71), Expect = 0.79 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 297 FLCTMIVALGPIQFGFTGGFSSPTQDAIIR 386 FL ALGP+ FGF G+SSP ++ R Sbjct: 27 FLAAFAAALGPLSFGFALGYSSPAIPSLRR 56
>ITCH_MOUSE (Q8C863) Itchy E3 ubiquitin protein ligase (EC 6.3.2.-)| Length = 864 Score = 29.3 bits (64), Expect = 5.1 Identities = 20/86 (23%), Positives = 36/86 (41%) Frame = -3 Query: 433 DSEPNTENSEMERLRSRMMASWVGEEKPPVKPNWMGPSATIMVQRKAETWDSRMMAMEEV 254 DS P ++ ++S++ + + + K NW GPS + V ++ + Sbjct: 3 DSGPQLDSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNS 62 Query: 253 PAVRLDWRDPIRYQLPVLTSSGCFRV 176 P W+ P+ + TS CFRV Sbjct: 63 P----KWKQPLTV-IVTPTSKLCFRV 83
>MCM3_SCHPO (P30666) DNA replication licensing factor mcm3 (Minichromosome| maintenance protein 3) Length = 879 Score = 28.9 bits (63), Expect = 6.7 Identities = 30/91 (32%), Positives = 41/91 (45%), Gaps = 2/91 (2%) Frame = +3 Query: 174 DTRKQPLLVNTGSWYR-MGSRQSSLTAGTSSMAIMRESHVSAFLCTMIVALGPIQ-FGFT 347 DT K VN YR MGS+ S T+ T ++ + +V LG G Sbjct: 232 DTVKPGDRVNIVGQYRSMGSKTSGNTSATFRTVLLANN---------VVLLGNKPGLGNV 282 Query: 348 GGFSSPTQDAIIRDLNLSISEFSVFGSLSTS 440 GG + DA IR++N + +VF LSTS Sbjct: 283 GGGALDITDADIRNINKLARKKNVFELLSTS 313
>DPP2_MOUSE (Q9ET22) Dipeptidyl-peptidase 2 precursor (EC 3.4.14.2)| (Dipeptidyl-peptidase II) (DPP II) (Dipeptidyl aminopeptidase II) (Quiescent cell proline dipeptidase) (Dipeptidyl peptidase 7) Length = 506 Score = 28.9 bits (63), Expect = 6.7 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Frame = -3 Query: 457 GADHGADV---DSEPNTENSEMERLRSRMMASWVGEE--KPPVKPNWMGP 323 G H D+ +SE E+ +L S ++ WV K P P W+GP Sbjct: 450 GGAHHLDLRASNSEDPPSVVEVRKLESTLIREWVAAARLKQPAMPRWLGP 499 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,430,405 Number of Sequences: 219361 Number of extensions: 409502 Number of successful extensions: 1408 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1407 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)