| Clone Name | baet96e04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y578_MYCPN (P75202) Hypothetical protein MPN578 (D02_orf100) | 28 | 5.9 | 2 | UVRC_THET8 (Q5SI32) UvrABC system protein C (Protein uvrC) (Exci... | 28 | 5.9 | 3 | HEX_ADECR (O39619) Hexon protein (Late protein 2) | 28 | 5.9 | 4 | HEX_ADECC (Q65955) Hexon protein (Late protein 2) | 28 | 5.9 | 5 | UN84A_MOUSE (Q9D666) Sad1/unc-84 protein-like 1 (Unc-84 homolog A) | 28 | 7.7 |
|---|
>Y578_MYCPN (P75202) Hypothetical protein MPN578 (D02_orf100)| Length = 100 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 99 WWWMTSSCNFLGGLQC*VRGWWAIPRPWACA*GVRFI 209 W WM N LG C G+WA R +A G+R + Sbjct: 65 WLWMRICHNCLG---CLCTGYWAAQRTFATTTGLRLV 98
>UVRC_THET8 (Q5SI32) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 590 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 187 ALKVFDSLPRRLGEHTHLSAISDLLGWVTRP 279 AL+ L R GEH L A+ DLLG RP Sbjct: 353 ALETELKLRERRGEHPALKALQDLLGLPARP 383
>HEX_ADECR (O39619) Hexon protein (Late protein 2)| Length = 905 Score = 28.1 bits (61), Expect = 5.9 Identities = 9/19 (47%), Positives = 17/19 (89%) Frame = +3 Query: 237 PFSHFRSAGLGYKAEMVGS 293 PF+H R+AGL Y+++++G+ Sbjct: 486 PFNHHRNAGLRYRSQLLGN 504
>HEX_ADECC (Q65955) Hexon protein (Late protein 2)| Length = 905 Score = 28.1 bits (61), Expect = 5.9 Identities = 9/19 (47%), Positives = 17/19 (89%) Frame = +3 Query: 237 PFSHFRSAGLGYKAEMVGS 293 PF+H R+AGL Y+++++G+ Sbjct: 486 PFNHHRNAGLRYRSQLLGN 504
>UN84A_MOUSE (Q9D666) Sad1/unc-84 protein-like 1 (Unc-84 homolog A)| Length = 913 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 1 LDLHLISYPSIPPPHRGAGCPGQL 72 L++H ++ +P PHR AG G+L Sbjct: 316 LEIHTATHSQLPQPHRVAGAMGRL 339 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,217,543 Number of Sequences: 219361 Number of extensions: 852294 Number of successful extensions: 2029 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2029 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)