| Clone Name | baet95h12 |
|---|---|
| Clone Library Name | barley_pub |
>YQP4_CAEEL (Q09531) Hypothetical protein F07F6.4 in chromosome III| Length = 529 Score = 114 bits (284), Expect = 1e-25 Identities = 52/80 (65%), Positives = 63/80 (78%), Gaps = 1/80 (1%) Frame = +3 Query: 210 DRSSVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNL 389 D + RK+R+ NK+CFDC A+NPTW +VTYGVFLCIDCSAVHR+LGVH++FVRSTNL Sbjct: 11 DLQTAMRKMRALPPNKLCFDCGARNPTWCTVTYGVFLCIDCSAVHRNLGVHLTFVRSTNL 70 Query: 390 D-SWTPEQLKMMVYGGNNRA 446 D +WT QL+ M GGN A Sbjct: 71 DTNWTWLQLRAMQLGGNGNA 90
>ARFG3_MOUSE (Q9D8S3) ADP-ribosylation factor GTPase-activating protein 3 (ARF| GAP 3) Length = 525 Score = 111 bits (278), Expect = 7e-25 Identities = 51/80 (63%), Positives = 64/80 (80%), Gaps = 1/80 (1%) Frame = +3 Query: 210 DRSSVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNL 389 D ++F++LRS NK+CFDC AKNP+WAS++YGVFLCIDCS HRSLGVH+SF+RST L Sbjct: 8 DILAIFKRLRSVPTNKVCFDCGAKNPSWASISYGVFLCIDCSGSHRSLGVHLSFIRSTEL 67 Query: 390 DS-WTPEQLKMMVYGGNNRA 446 DS W+ QL+ M GGN+ A Sbjct: 68 DSNWSWFQLRCMQVGGNSNA 87
>ARFG3_HUMAN (Q9NP61) ADP-ribosylation factor GTPase-activating protein 3 (ARF| GAP 3) Length = 516 Score = 111 bits (278), Expect = 7e-25 Identities = 52/80 (65%), Positives = 63/80 (78%), Gaps = 1/80 (1%) Frame = +3 Query: 210 DRSSVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNL 389 D ++F++LRS NK+CFDC AKNP+WAS+TYGVFLCIDCS HRSLGVH+SF+RST L Sbjct: 8 DILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTEL 67 Query: 390 DS-WTPEQLKMMVYGGNNRA 446 DS W+ QL+ M GGN A Sbjct: 68 DSNWSWFQLRCMQVGGNASA 87
>YDBH_SCHPO (Q10367) Hypothetical protein C22E12.17c in chromosome I| Length = 486 Score = 109 bits (273), Expect = 3e-24 Identities = 48/83 (57%), Positives = 63/83 (75%), Gaps = 3/83 (3%) Frame = +3 Query: 210 DRSSVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFV---RS 380 + + LRS+ DNK+CFDC AKNPTW+S T+G++LC+DCSA HR++GVH+SFV RS Sbjct: 7 ESQKLLTSLRSQRDNKVCFDCGAKNPTWSSTTFGIYLCLDCSAAHRNMGVHISFVRFLRS 66 Query: 381 TNLDSWTPEQLKMMVYGGNNRAQ 449 T LDSWT QL++M GGN A+ Sbjct: 67 TVLDSWTYAQLRVMRVGGNENAR 89
>GLO3_YEAST (P38682) ADP-ribosylation factor GTPase-activating protein GLO3| Length = 493 Score = 103 bits (258), Expect = 2e-22 Identities = 43/76 (56%), Positives = 58/76 (76%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 VF+KL S +N++CFDC KNPTW SV +GV LCI CSAVHR++GVH++FV+S+ LD WT Sbjct: 18 VFQKLGSNMENRVCFDCGNKNPTWTSVPFGVMLCIQCSAVHRNMGVHITFVKSSTLDKWT 77 Query: 402 PEQLKMMVYGGNNRAQ 449 L+ GGN++A+ Sbjct: 78 INNLRRFKLGGNHKAR 93
>SMAP1_MOUSE (Q91VZ6) Stromal membrane-associated protein 1| Length = 440 Score = 95.5 bits (236), Expect = 5e-20 Identities = 41/76 (53%), Positives = 53/76 (69%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 + KL + DNK C DC AK P WAS GVF+CI C+ +HR+LGVH+S V+S NLD WT Sbjct: 20 ILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWT 79 Query: 402 PEQLKMMVYGGNNRAQ 449 PEQ++ M GN +A+ Sbjct: 80 PEQIQCMQDMGNTKAR 95
>SMAP1_HUMAN (Q8IYB5) Stromal membrane-associated protein 1| Length = 467 Score = 92.4 bits (228), Expect = 5e-19 Identities = 40/76 (52%), Positives = 52/76 (68%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 + KL + DNK C DC AK P WAS GVF+CI C+ +HR+LGVH+S V+S NLD WT Sbjct: 20 ILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWT 79 Query: 402 PEQLKMMVYGGNNRAQ 449 EQ++ M GN +A+ Sbjct: 80 AEQIQCMQDMGNTKAR 95
>ARFG1_RAT (Q62848) ADP-ribosylation factor GTPase-activating protein 1| (ADP-ribosylation factor 1 GTPase-activating protein) (ARF1 GAP) (ARF1-directed GTPase-activating protein) (GAP protein) Length = 415 Score = 92.0 bits (227), Expect = 6e-19 Identities = 36/72 (50%), Positives = 53/72 (73%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 V +++R++ +N +CF+C A NP W SVTYG+++C++CS HR LGVH+SFVRS +D W Sbjct: 9 VLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWK 68 Query: 402 PEQLKMMVYGGN 437 +L+ M GGN Sbjct: 69 DIELEKMKAGGN 80
>ARFG1_MOUSE (Q9EPJ9) ADP-ribosylation factor GTPase-activating protein 1| (ADP-ribosylation factor 1 GTPase-activating protein) (ARF1 GAP) (ARF1-directed GTPase-activating protein) (GAP protein) Length = 414 Score = 92.0 bits (227), Expect = 6e-19 Identities = 36/72 (50%), Positives = 53/72 (73%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 V +++R++ +N +CF+C A NP W SVTYG+++C++CS HR LGVH+SFVRS +D W Sbjct: 9 VLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWK 68 Query: 402 PEQLKMMVYGGN 437 +L+ M GGN Sbjct: 69 DIELEKMKAGGN 80
>SMP1L_CHICK (Q5F413) Stromal membrane-associated protein 1-like| Length = 428 Score = 91.3 bits (225), Expect = 1e-18 Identities = 40/76 (52%), Positives = 52/76 (68%) Frame = +3 Query: 219 SVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSW 398 +V L S+ +NK C DC AK P WAS GVF+CI C+ +HR+LGVH+S V+S NLD W Sbjct: 14 AVLGSLLSEEENKYCADCQAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQW 73 Query: 399 TPEQLKMMVYGGNNRA 446 T EQ++ M GN +A Sbjct: 74 TQEQIQCMQEMGNGKA 89
>ARFG1_HUMAN (Q8N6T3) ADP-ribosylation factor GTPase-activating protein 1| (ADP-ribosylation factor 1 GTPase-activating protein) (ARF1 GAP) (ARF1-directed GTPase-activating protein) (GAP protein) Length = 406 Score = 90.9 bits (224), Expect = 1e-18 Identities = 36/72 (50%), Positives = 52/72 (72%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 V +++R + +N +CF+C A NP W SVTYG+++C++CS HR LGVH+SFVRS +D W Sbjct: 9 VLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWK 68 Query: 402 PEQLKMMVYGGN 437 +L+ M GGN Sbjct: 69 DIELEKMKAGGN 80
>SMP1L_MOUSE (Q7TN29) Stromal membrane-associated protein 1-like (Stromal| membrane-associated protein 2) Length = 428 Score = 90.1 bits (222), Expect = 2e-18 Identities = 39/76 (51%), Positives = 51/76 (67%) Frame = +3 Query: 219 SVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSW 398 +V L + DNK C DC +K P WAS GVF+CI C+ +HR+LGVH+S V+S NLD W Sbjct: 14 AVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQW 73 Query: 399 TPEQLKMMVYGGNNRA 446 T EQ++ M GN +A Sbjct: 74 TQEQIQCMQEMGNGKA 89
>SMP1L_HUMAN (Q8WU79) Stromal membrane-associated protein 1-like| Length = 429 Score = 90.1 bits (222), Expect = 2e-18 Identities = 39/76 (51%), Positives = 51/76 (67%) Frame = +3 Query: 219 SVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSW 398 +V L + DNK C DC +K P WAS GVF+CI C+ +HR+LGVH+S V+S NLD W Sbjct: 14 AVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQW 73 Query: 399 TPEQLKMMVYGGNNRA 446 T EQ++ M GN +A Sbjct: 74 TQEQIQCMQEMGNGKA 89
>SMP1L_BOVIN (Q5EA00) Stromal membrane-associated protein 1-like| Length = 429 Score = 90.1 bits (222), Expect = 2e-18 Identities = 39/76 (51%), Positives = 51/76 (67%) Frame = +3 Query: 219 SVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSW 398 +V L + DNK C DC +K P WAS GVF+CI C+ +HR+LGVH+S V+S NLD W Sbjct: 14 AVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQW 73 Query: 399 TPEQLKMMVYGGNNRA 446 T EQ++ M GN +A Sbjct: 74 TQEQIQCMQEMGNGKA 89
>CENB5_HUMAN (Q96P50) Centaurin-beta 5 (Cnt-b5)| Length = 759 Score = 89.4 bits (220), Expect = 4e-18 Identities = 40/74 (54%), Positives = 51/74 (68%) Frame = +3 Query: 219 SVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSW 398 SV ++++S + N C DC +P WAS+ GV LCI+CS +HRSLGVH S VRS LDSW Sbjct: 362 SVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSW 421 Query: 399 TPEQLKMMVYGGNN 440 PE LK+M GN+ Sbjct: 422 EPELLKLMCELGNS 435
>GCS1_YEAST (P35197) ADP-ribosylation factor GTPase-activating protein GCS1| Length = 352 Score = 84.7 bits (208), Expect = 9e-17 Identities = 34/69 (49%), Positives = 47/69 (68%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQ 410 +L+ NK C DC A NP WA+ +G F+C++C+ +HR LGVH+SFVRS +D + PE+ Sbjct: 16 QLQKIGANKKCMDCGAPNPQWATPKFGAFICLECAGIHRGLGVHISFVRSITMDQFKPEE 75 Query: 411 LKMMVYGGN 437 L M GGN Sbjct: 76 LLRMEKGGN 84
>CENB2_HUMAN (Q15057) Centaurin-beta 2 (Cnt-b2)| Length = 778 Score = 82.0 bits (201), Expect = 6e-16 Identities = 36/74 (48%), Positives = 48/74 (64%) Frame = +3 Query: 219 SVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSW 398 S ++++ N C DC +P WAS+ G+ LCI+CS +HRSLGVH S VRS LD+W Sbjct: 400 SALQRVQCIPGNASCCDCGLADPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTW 459 Query: 399 TPEQLKMMVYGGNN 440 PE LK+M GN+ Sbjct: 460 EPELLKLMCELGND 473
>CENB1_HUMAN (Q15027) Centaurin-beta 1 (Cnt-b1)| Length = 740 Score = 81.6 bits (200), Expect = 8e-16 Identities = 38/72 (52%), Positives = 45/72 (62%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 V +++S N C DC P WAS+ GV LCI CS +HRSLGVH S VRS LDSW Sbjct: 407 VVAQVQSVDGNAQCCDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWE 466 Query: 402 PEQLKMMVYGGN 437 PE +K+M GN Sbjct: 467 PELVKLMCELGN 478
>CENG2_XENLA (Q6NRL1) Centaurin-gamma 2| Length = 864 Score = 81.3 bits (199), Expect = 1e-15 Identities = 34/73 (46%), Positives = 49/73 (67%) Frame = +3 Query: 228 RKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPE 407 + +R+ N C DC+A++P WAS+ G +CI+CS +HR+LG H+S VRS +LD W PE Sbjct: 616 QSIRNLPGNSHCVDCDAQSPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPPE 675 Query: 408 QLKMMVYGGNNRA 446 +K+M GN A Sbjct: 676 LIKVMSAIGNELA 688
>CENG3_MOUSE (Q8VHH5) Centaurin-gamma 3 (ARF-GAP with GTP-binding protein-like,| ankyrin repeat and pleckstrin homology domains 3) (AGAP-3) (MR1-interacting protein) (MRIP-1) (CRAM-associated GTPase) (CRAG) Length = 910 Score = 81.3 bits (199), Expect = 1e-15 Identities = 34/68 (50%), Positives = 44/68 (64%) Frame = +3 Query: 234 LRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQL 413 +R+ N +C DC A NP WAS+ G +CI+CS +HR LG H+S VRS +LD W PE L Sbjct: 667 VRTVRGNSLCIDCEAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELL 726 Query: 414 KMMVYGGN 437 +M GN Sbjct: 727 AVMTAMGN 734
>CENG3_HUMAN (Q96P47) Centaurin-gamma 3 (ARF-GAP with GTP-binding protein-like,| ankyrin repeat and pleckstrin homology domains 3) (AGAP-3) (MR1-interacting protein) (MRIP-1) (CRAM-associated GTPase) (CRAG) Length = 875 Score = 80.9 bits (198), Expect = 1e-15 Identities = 34/68 (50%), Positives = 44/68 (64%) Frame = +3 Query: 234 LRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQL 413 +R+ N C DC+A NP WAS+ G +CI+CS +HR LG H+S VRS +LD W PE L Sbjct: 632 VRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELL 691 Query: 414 KMMVYGGN 437 +M GN Sbjct: 692 AVMTAMGN 699
>CENG1_HUMAN (Q99490) Centaurin-gamma 1 (ARF-GAP with GTP-binding protein-like,| ankyrin repeat and pleckstrin homology domains 2) (AGAP-2) (Phosphatidylinositol-3-kinase enhancer) (PIKE) (GTP-binding and GTPase activating protein 2) (GGAP2) Length = 1192 Score = 79.0 bits (193), Expect = 5e-15 Identities = 33/71 (46%), Positives = 46/71 (64%) Frame = +3 Query: 234 LRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQL 413 +R+ N +C DC A NPTWAS+ G +CI+CS +HR+LG H+S VRS +LD W E Sbjct: 937 IRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELT 996 Query: 414 KMMVYGGNNRA 446 ++ GN+ A Sbjct: 997 LVLTAIGNDTA 1007
>CENG2_MOUSE (Q8BXK8) Centaurin-gamma 2 (ARF-GAP with GTP-binding protein-like,| ankyrin repeat and pleckstrin homology domains 1) (AGAP-1) Length = 857 Score = 79.0 bits (193), Expect = 5e-15 Identities = 33/73 (45%), Positives = 47/73 (64%) Frame = +3 Query: 228 RKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPE 407 + +R+ N C DC+ +NP WAS+ G +CI+CS +HR+LG H+S VRS +LD W E Sbjct: 613 QSIRNMRGNSHCVDCDTQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPME 672 Query: 408 QLKMMVYGGNNRA 446 +K+M GN A Sbjct: 673 LIKVMSSIGNELA 685
>CENG1_RAT (Q8CGU4) Centaurin-gamma 1 (ARF-GAP with GTP-binding protein-like,| ankyrin repeat and pleckstrin homology domains 2) (AGAP-2) (Phosphatidylinositol-3-kinase enhancer) (PIKE) Length = 1186 Score = 78.2 bits (191), Expect = 9e-15 Identities = 33/71 (46%), Positives = 45/71 (63%) Frame = +3 Query: 234 LRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQL 413 +R+ N C DC A NPTWAS+ G +CI+CS +HR+LG H+S VRS +LD W E Sbjct: 931 IRNAKGNSTCVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELT 990 Query: 414 KMMVYGGNNRA 446 ++ GN+ A Sbjct: 991 LVLTAIGNDTA 1001
>CENG1_MOUSE (Q3UHD9) Centaurin-gamma 1 (ARF-GAP with GTP-binding protein-like,| ankyrin repeat and pleckstrin homology domains 2) (AGAP-2) (Phosphatidylinositol-3-kinase enhancer) (PIKE) Length = 1186 Score = 78.2 bits (191), Expect = 9e-15 Identities = 33/71 (46%), Positives = 45/71 (63%) Frame = +3 Query: 234 LRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQL 413 +R+ N C DC A NPTWAS+ G +CI+CS +HR+LG H+S VRS +LD W E Sbjct: 931 IRNAKGNSTCVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELT 990 Query: 414 KMMVYGGNNRA 446 ++ GN+ A Sbjct: 991 LVLTAIGNDTA 1001
>CENG2_HUMAN (Q9UPQ3) Centaurin-gamma 2 (ARF-GAP with GTP-binding protein-like,| ankyrin repeat and pleckstrin homology domains 1) (AGAP-1) (GTP-binding and GTPase-activating protein 1) (GGAP1) Length = 857 Score = 78.2 bits (191), Expect = 9e-15 Identities = 33/73 (45%), Positives = 46/73 (63%) Frame = +3 Query: 228 RKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPE 407 + +R+ N C DC +NP WAS+ G +CI+CS +HR+LG H+S VRS +LD W E Sbjct: 613 QSIRNMRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPIE 672 Query: 408 QLKMMVYGGNNRA 446 +K+M GN A Sbjct: 673 LIKVMSSIGNELA 685
>CEG1A_DROME (Q9NGC3) Centaurin-gamma 1A| Length = 995 Score = 77.4 bits (189), Expect = 2e-14 Identities = 34/65 (52%), Positives = 42/65 (64%) Frame = +3 Query: 252 NKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMMVYG 431 N C DC A NP WAS+ GV +CI+CS VHR+LG H+S VRS LD W L +M+ Sbjct: 714 NGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAI 773 Query: 432 GNNRA 446 GN+ A Sbjct: 774 GNSLA 778
>UCP3_SCHPO (O74345) UBA domain-containing protein 3| Length = 601 Score = 75.9 bits (185), Expect = 4e-14 Identities = 31/79 (39%), Positives = 51/79 (64%) Frame = +3 Query: 210 DRSSVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNL 389 + +++ ++S S N +C DC+ + WAS G+FLC+ C+ +HR LG HVS V+S +L Sbjct: 6 NETAIRELVQSVSGNNLCADCSTRGVQWASWNLGIFLCLRCATIHRKLGTHVSKVKSISL 65 Query: 390 DSWTPEQLKMMVYGGNNRA 446 D W+ +Q++ M + GN A Sbjct: 66 DEWSNDQIEKMKHWGNINA 84
>AGE2_YEAST (P40529) Protein AGE2| Length = 298 Score = 70.9 bits (172), Expect = 1e-12 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = +3 Query: 252 NKMCFDCNAK-NPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMMVY 428 N C DC A+ +P WAS + GVF+CI C+ +HRSLG H+S V+S +LD+W E L ++ Sbjct: 20 NSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVKLIQ 79 Query: 429 GGNN 440 NN Sbjct: 80 FKNN 83
>CENA1_HUMAN (O75689) Centaurin-alpha 1 (Putative MAPK-activating protein PM25)| Length = 374 Score = 69.7 bits (169), Expect = 3e-12 Identities = 32/80 (40%), Positives = 47/80 (58%) Frame = +3 Query: 210 DRSSVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNL 389 +R +L + N C DC A +P WAS T GVF+C+ CS +HR++ VS V+S L Sbjct: 4 ERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNI-PQVSKVKSVRL 62 Query: 390 DSWTPEQLKMMVYGGNNRAQ 449 D+W Q++ M GN+ A+ Sbjct: 63 DAWEEAQVEFMASHGNDAAR 82
>GIT2_MOUSE (Q9JLQ2) ARF GTPase-activating protein GIT2 (G protein-coupled| receptor kinase-interactor 2) (Cool-interacting tyrosine-phosphorylated protein 2) (CAT2) (CAT-2) Length = 708 Score = 67.8 bits (164), Expect = 1e-11 Identities = 33/73 (45%), Positives = 45/73 (61%) Frame = +3 Query: 228 RKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPE 407 ++LRS +C DCN +P+WASV G F+C +C +VHRSLG H+S VR +W P Sbjct: 3 KRLRSSD---VCADCNGPDPSWASVNRGTFICDECCSVHRSLGRHISQVRHLKHTAWPPT 59 Query: 408 QLKMMVYGGNNRA 446 L+M+ NN A Sbjct: 60 LLQMVETLYNNGA 72
>GIT2_HUMAN (Q14161) ARF GTPase-activating protein GIT2 (G protein-coupled| receptor kinase-interactor 2) (GRK-interacting protein 2) (Cool-interacting tyrosine-phosphorylated protein 2) (CAT2) (CAT-2) Length = 759 Score = 66.6 bits (161), Expect = 3e-11 Identities = 33/73 (45%), Positives = 46/73 (63%) Frame = +3 Query: 228 RKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPE 407 ++LRS +++C DC+ +P+WASV G FLC +C +VHRSLG H+S VR W P Sbjct: 3 KRLRS---SEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPT 59 Query: 408 QLKMMVYGGNNRA 446 L+M+ NN A Sbjct: 60 LLQMVETLYNNGA 72
>DDFL1_HUMAN (Q8TDY4) Development and differentiation enhancing factor-like 1| (Protein up-regulated in liver cancer 1) Length = 903 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/69 (43%), Positives = 40/69 (57%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQ 410 +++S+ N C DC A +PTW S GV CI CS VHR LGV S ++S LD P + Sbjct: 431 EVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSE 490 Query: 411 LKMMVYGGN 437 L + + GN Sbjct: 491 LLLALNMGN 499
>DDFL1_MOUSE (Q5U464) Development and differentiation enhancing factor-like 1| Length = 904 Score = 66.2 bits (160), Expect = 3e-11 Identities = 30/70 (42%), Positives = 41/70 (58%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQ 410 +++S+ N C DC A +PTW S GV CI CS VHR LGV S ++S LD P + Sbjct: 430 EVKSRPGNDRCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRIQSLTLDLLGPSE 489 Query: 411 LKMMVYGGNN 440 L + + GN+ Sbjct: 490 LLLALNIGNS 499
>DDEF1_MOUSE (Q9QWY8) 130-kDa phosphatidylinositol 4,5-biphosphate-dependent| ARF1 GTPase-activating protein (PIP2-dependent ARF1 GAP) (ADP-ribosylation factor-directed GTPase-activating protein 1) (ARF GTPase-activating protein 1) (Development and differe Length = 1147 Score = 65.5 bits (158), Expect = 6e-11 Identities = 26/63 (41%), Positives = 37/63 (58%) Frame = +3 Query: 252 NKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMMVYG 431 N +C DC + PTW S G+ CI+CS +HR +GVH+S ++S LD +L + Sbjct: 466 NDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNV 525 Query: 432 GNN 440 GNN Sbjct: 526 GNN 528
>DDEF1_HUMAN (Q9ULH1) 130-kDa phosphatidylinositol 4,5-biphosphate-dependent| ARF1 GTPase-activating protein (PIP2-dependent ARF1 GAP) (ADP-ribosylation factor-directed GTPase-activating protein 1) (ARF GTPase-activating protein 1) (Development and differe Length = 956 Score = 65.5 bits (158), Expect = 6e-11 Identities = 26/63 (41%), Positives = 37/63 (58%) Frame = +3 Query: 252 NKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMMVYG 431 N +C DC + PTW S G+ CI+CS +HR +GVH+S ++S LD +L + Sbjct: 278 NDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNV 337 Query: 432 GNN 440 GNN Sbjct: 338 GNN 340
>DDEF1_BOVIN (O97902) 130-kDa phosphatidylinositol 4,5-biphosphate-dependent| ARF1 GTPase-activating protein (PIP2-dependent ARF1 GAP) (ADP-ribosylation factor-directed GTPase-activating protein 1) (ARF GTPase-activating protein 1) (Development and differe Length = 1129 Score = 65.1 bits (157), Expect = 8e-11 Identities = 26/63 (41%), Positives = 37/63 (58%) Frame = +3 Query: 252 NKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMMVYG 431 N +C DC + PTW S G+ CI+CS +HR +GVH+S ++S LD +L + Sbjct: 454 NDVCCDCGSAEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNV 513 Query: 432 GNN 440 GNN Sbjct: 514 GNN 516
>CSX2_SCHPO (Q9UUE2) Protein csx2| Length = 870 Score = 64.7 bits (156), Expect = 1e-10 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = +3 Query: 246 SDNKMCFDCNAK-NPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMM 422 S ++ C DCN W ++ + V LCIDCS +HRSLG H++ +RS LD + PE + ++ Sbjct: 681 SSDQSCADCNTTARVEWCAINFPVVLCIDCSGIHRSLGTHITKIRSLTLDKFNPETVDLL 740 Query: 423 VYGGNN 440 GN+ Sbjct: 741 YATGNS 746
>CEND3_MOUSE (Q8R5G7) Centaurin-delta 3 (Cnt-d3) (Arf-GAP, Rho-GAP, ankyrin| repeat and pleckstrin homology domain-containing protein 3) (Dual specificity Rho- and Arf-GTPase-activating protein 1) Length = 1538 Score = 63.9 bits (154), Expect = 2e-10 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 2/77 (2%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDS-- 395 V K+ S N+ C DC A P WA+V GV +C C+ HR+LG +S V+S LD+ Sbjct: 486 VAEKVWSNPANRHCADCRASRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSV 545 Query: 396 WTPEQLKMMVYGGNNRA 446 W+ E +++ + GN+RA Sbjct: 546 WSNEIVQLFIVLGNDRA 562
>CEND3_HUMAN (Q8WWN8) Centaurin-delta 3 (Cnt-d3) (Arf-GAP, Rho-GAP, ankyrin| repeat and pleckstrin homology domain-containing protein 3) Length = 1544 Score = 63.9 bits (154), Expect = 2e-10 Identities = 30/77 (38%), Positives = 46/77 (59%), Gaps = 2/77 (2%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDS-- 395 V K+ S N+ C DC + P WA+V GV +C C+ HR+LG +S V+S LD+ Sbjct: 491 VAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSV 550 Query: 396 WTPEQLKMMVYGGNNRA 446 W+ E +++ + GN+RA Sbjct: 551 WSNEIVQLFIVLGNDRA 567
>GIT1_RAT (Q9Z272) ARF GTPase-activating protein GIT1 (G protein-coupled| receptor kinase-interactor 1) (GRK-interacting protein 1) (Cool-associated and tyrosine-phosphorylated protein 1) (Cat-1) Length = 770 Score = 63.5 bits (153), Expect = 2e-10 Identities = 25/56 (44%), Positives = 39/56 (69%) Frame = +3 Query: 255 KMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMM 422 ++C DC+A +P WAS++ GV +C +C +VHRSLG H+S V+ +W P L+M+ Sbjct: 9 EVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMV 64
>GIT1_MOUSE (Q68FF6) ARF GTPase-activating protein GIT1 (G protein-coupled| receptor kinase-interactor 1) (GRK-interacting protein 1) Length = 770 Score = 63.5 bits (153), Expect = 2e-10 Identities = 25/56 (44%), Positives = 39/56 (69%) Frame = +3 Query: 255 KMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMM 422 ++C DC+A +P WAS++ GV +C +C +VHRSLG H+S V+ +W P L+M+ Sbjct: 9 EVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMV 64
>GIT1_HUMAN (Q9Y2X7) ARF GTPase-activating protein GIT1 (G protein-coupled| receptor kinase-interactor 1) (GRK-interacting protein 1) (Cool-associated and tyrosine-phosphorylated protein 1) (Cat-1) Length = 761 Score = 63.5 bits (153), Expect = 2e-10 Identities = 25/56 (44%), Positives = 39/56 (69%) Frame = +3 Query: 255 KMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMM 422 ++C DC+A +P WAS++ GV +C +C +VHRSLG H+S V+ +W P L+M+ Sbjct: 9 EVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMV 64
>DDEF2_HUMAN (O43150) Development and differentiation-enhancing factor 2 (Pyk2| C-terminus-associated protein) (PAP) (Paxillin-associated protein with ARFGAP activity 3) (PAG3) Length = 1006 Score = 62.8 bits (151), Expect = 4e-10 Identities = 27/72 (37%), Positives = 41/72 (56%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 + +++ + N +C DC A +PTW S G+ CI+CS +HR LGVH S ++S LD Sbjct: 423 IISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLG 482 Query: 402 PEQLKMMVYGGN 437 +L + GN Sbjct: 483 TSELLLAKNIGN 494
>DDEF2_MOUSE (Q7SIG6) Development and differentiation-enhancing factor 2 (Pyk2| C-terminus associated protein) (PAP) (Paxillin-associated protein with ARFGAP activity 3) (PAG3) Length = 958 Score = 62.8 bits (151), Expect = 4e-10 Identities = 27/72 (37%), Positives = 41/72 (56%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 + +++ + N +C DC A +PTW S G+ CI+CS +HR LGVH S ++S LD Sbjct: 426 IISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLG 485 Query: 402 PEQLKMMVYGGN 437 +L + GN Sbjct: 486 TSELLLAKNIGN 497
>YAUA_SCHPO (Q10165) Hypothetical protein C26A3.10 in chromosome I| Length = 923 Score = 62.4 bits (150), Expect = 5e-10 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 3/77 (3%) Frame = +3 Query: 216 SSVFRKLRSKSD--NKMCFDCNA-KNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTN 386 +++F ++ K+D N +C DC + K+ TW S+ V LCI+CS +HRSLG H+S RS Sbjct: 713 ANIFIQMLRKTDVSNSVCADCGSVKDVTWCSINIPVVLCIECSGIHRSLGTHISKTRSLL 772 Query: 387 LDSWTPEQLKMMVYGGN 437 LDS + + ++ GN Sbjct: 773 LDSLSQQSKVLLCKIGN 789
>CENA2_RAT (Q9JK15) Centaurin-alpha 2| Length = 376 Score = 60.8 bits (146), Expect = 1e-09 Identities = 27/62 (43%), Positives = 36/62 (58%) Frame = +3 Query: 252 NKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMMVYG 431 N C DC A +P WAS GVF+C+ CS VHR+ +S V+S LD W ++ M + Sbjct: 22 NGHCADCGAADPDWASYKLGVFICLHCSGVHRNF-PDISKVKSVRLDFWDDSMVEFMTHN 80 Query: 432 GN 437 GN Sbjct: 81 GN 82
>CENA2_HUMAN (Q9NPF8) Centaurin-alpha 2| Length = 381 Score = 60.8 bits (146), Expect = 1e-09 Identities = 26/66 (39%), Positives = 39/66 (59%) Frame = +3 Query: 252 NKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMMVYG 431 N C DC A +P WAS G+F+C++C VHR+ +S V+S LD W ++ M++ Sbjct: 22 NAHCADCGAADPDWASYKLGIFICLNCCGVHRNF-PDISRVKSVRLDFWDDSIVEFMIHN 80 Query: 432 GNNRAQ 449 GN R + Sbjct: 81 GNLRVK 86
>CEND1_HUMAN (Q8WZ64) Centaurin-delta 1 (Cnt-d1) (Arf-GAP, Rho-GAP, ankyrin| repeat and pleckstrin homology domain-containing protein 2) (PARX protein) Length = 1704 Score = 60.8 bits (146), Expect = 1e-09 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDS-- 395 V K+ N+ C DC A +P WAS+ V +C C+ HRSLG S VRS +D+ Sbjct: 687 VAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASI 746 Query: 396 WTPEQLKMMVYGGNNRA 446 W+ E +++ + GN RA Sbjct: 747 WSNELIELFIVIGNKRA 763
>CENA2_MOUSE (Q8R2V5) Centaurin-alpha 2| Length = 381 Score = 59.7 bits (143), Expect = 3e-09 Identities = 26/62 (41%), Positives = 36/62 (58%) Frame = +3 Query: 252 NKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMMVYG 431 N C DC A +P WAS G+F+C+ CS VHR+ +S V+S LD W ++ M + Sbjct: 22 NGHCADCGAADPDWASYKLGIFICLHCSGVHRNF-PDISKVKSVRLDFWDDSMVEFMTHH 80 Query: 432 GN 437 GN Sbjct: 81 GN 82
>SPS18_YEAST (P32572) Sporulation protein SPS18 (Sporulation-specific protein| SPX18) Length = 300 Score = 59.7 bits (143), Expect = 3e-09 Identities = 24/74 (32%), Positives = 48/74 (64%), Gaps = 2/74 (2%) Frame = +3 Query: 228 RKLRSK--SDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 R LR+K + N CF+C + NP + S ++G+F+C++C+ + R +G ++ V+S +D++ Sbjct: 15 RLLRAKKAAGNNNCFECKSVNPQFVSCSFGIFICVNCANLLRGMGTNIFCVKSITMDNFE 74 Query: 402 PEQLKMMVYGGNNR 443 + ++ + GNNR Sbjct: 75 EKDVRRVEKSGNNR 88
>CEND1_MOUSE (Q8BZ05) Centaurin-delta 1 (Cnt-d1)| Length = 1703 Score = 58.9 bits (141), Expect = 6e-09 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 2/77 (2%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDS-- 395 V K+ N+ C DC A +P WAS+ V +C C+ HRSLG VRS +D+ Sbjct: 685 VAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDCKVRSLKMDASI 744 Query: 396 WTPEQLKMMVYGGNNRA 446 W+ E +++ + GN RA Sbjct: 745 WSNELIELFIVIGNKRA 761
>CEND2_HUMAN (Q96P48) Centaurin-delta 2 (Cnt-d2) (Arf-GAP, Rho-GAP, ankyrin| repeat and pleckstrin homology domain-containing protein 1) Length = 1210 Score = 57.8 bits (138), Expect = 1e-08 Identities = 28/76 (36%), Positives = 41/76 (53%), Gaps = 2/76 (2%) Frame = +3 Query: 216 SSVFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDS 395 S V ++ + + N+ C DC A P WAS+ V +C C+ HR LG VS VRS +D Sbjct: 295 SEVAERIWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDR 354 Query: 396 --WTPEQLKMMVYGGN 437 WT +++ + GN Sbjct: 355 KVWTETLIELFLQLGN 370
>AGE1_YEAST (Q04412) ARF GAP effector protein 1 (ADP-ribosylation factor| GTPase-activating protein effector protein 1) (Suppressor of ARF1 thermosensitive mutant protein 1) Length = 482 Score = 53.1 bits (126), Expect = 3e-07 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = +3 Query: 219 SVFRKLRSKSDNKMCFDCNAKNPT-WASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDS 395 S+ RK+ N C DC + W S+ LCI CS VHRSLG H+S +RS LD+ Sbjct: 174 SIVRKI--DKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDN 231 Query: 396 WTPEQL 413 +T +L Sbjct: 232 FTSLEL 237
>GTS1_YEAST (P40956) Protein GTS1 (Protein LSR1)| Length = 396 Score = 52.0 bits (123), Expect = 7e-07 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 5/75 (6%) Frame = +3 Query: 234 LRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSL-----GVHVSFVRSTNLDSW 398 + S + C +C PTW SV GVFLC C++VHR + S V+S ++D W Sbjct: 21 INSSENANKCGECGNFYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSNVKSLSMDRW 80 Query: 399 TPEQLKMMVYGGNNR 443 T E + +V G N+ Sbjct: 81 TREDIDELVSLGGNK 95
>NUPL_RAT (Q4KLH5) Nucleoporin-like protein RIP (HIV-1 Rev-binding protein| homolog) Length = 561 Score = 46.6 bits (109), Expect = 3e-05 Identities = 21/72 (29%), Positives = 40/72 (55%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 + R + N+ CFDC+ + PT+ ++T G F+C CS R L V+S ++ ++T Sbjct: 16 MLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLN-PPHRVKSISMTTFT 74 Query: 402 PEQLKMMVYGGN 437 ++++ + GN Sbjct: 75 QQEIEFLQKHGN 86
>NUPL_MOUSE (Q8K2K6) Nucleoporin-like protein RIP (HIV-1 Rev-binding protein| homolog) Length = 561 Score = 46.6 bits (109), Expect = 3e-05 Identities = 21/72 (29%), Positives = 40/72 (55%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 + R + N+ CFDC+ + PT+ ++T G F+C CS R L V+S ++ ++T Sbjct: 16 MLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLN-PPHRVKSISMTTFT 74 Query: 402 PEQLKMMVYGGN 437 ++++ + GN Sbjct: 75 QQEIEFLQKHGN 86
>NUPL_HUMAN (P52594) Nucleoporin-like protein RIP (HIV-1 Rev-binding protein)| (Rev-interacting protein) (Rev/Rex activation domain-binding protein) Length = 562 Score = 46.6 bits (109), Expect = 3e-05 Identities = 21/72 (29%), Positives = 40/72 (55%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 + R + N+ CFDC+ + PT+ ++T G F+C CS R L V+S ++ ++T Sbjct: 16 MLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLN-PPHRVKSISMTTFT 74 Query: 402 PEQLKMMVYGGN 437 ++++ + GN Sbjct: 75 QQEIEFLQKHGN 86
>NUPL_BOVIN (Q2TA45) Nucleoporin-like protein RIP (HIV-1 Rev-binding protein| homolog) Length = 562 Score = 46.6 bits (109), Expect = 3e-05 Identities = 21/72 (29%), Positives = 40/72 (55%) Frame = +3 Query: 222 VFRKLRSKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWT 401 + R + N+ CFDC+ + PT+ ++T G F+C CS R L V+S ++ ++T Sbjct: 16 MLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLN-PPHRVKSISMTTFT 74 Query: 402 PEQLKMMVYGGN 437 ++++ + GN Sbjct: 75 QQEIEFLQKHGN 86
>HRBL_MOUSE (Q80WC7) HIV-1 Rev-binding protein-like protein (Rev/Rex activation| domain binding protein-related) (RAB-R) Length = 479 Score = 39.7 bits (91), Expect = 0.003 Identities = 19/66 (28%), Positives = 36/66 (54%) Frame = +3 Query: 240 SKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKM 419 S++ N+ CF+C + T+ +T G F+C CS + R L V+S ++ ++T ++ Sbjct: 40 SQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLN-PPHRVKSISMTTFTEPEVLF 98 Query: 420 MVYGGN 437 + GN Sbjct: 99 LQSRGN 104
>HRBL_HUMAN (O95081) HIV-1 Rev-binding protein-like protein (Rev/Rex activation| domain-binding protein-related) (RAB-R) Length = 481 Score = 39.7 bits (91), Expect = 0.003 Identities = 19/66 (28%), Positives = 36/66 (54%) Frame = +3 Query: 240 SKSDNKMCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKM 419 S++ N+ CF+C + T+ +T G F+C CS + R L V+S ++ ++T ++ Sbjct: 40 SQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLN-PPHRVKSISMTTFTEPEVVF 98 Query: 420 MVYGGN 437 + GN Sbjct: 99 LQSRGN 104
>GATA3_BRARE (Q91428) Transcription factor GATA-3 (GATA-binding factor 3)| Length = 438 Score = 31.6 bits (70), Expect = 0.95 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAKN-PTWASVTYGVFLCIDCSAVHRSLG 356 K RS S+ + C +C A + P W G +LC C H+ G Sbjct: 246 KTRSSSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNG 288
>GATA3_CHICK (P23825) GATA-binding factor 3 (GATA-3) (Transcription factor| NF-E1C) Length = 444 Score = 30.4 bits (67), Expect = 2.1 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAKN-PTWASVTYGVFLCIDCSAVHRSLG 356 K RS ++ + C +C A + P W G +LC C H+ G Sbjct: 254 KARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNG 296
>GATA3_MOUSE (P23772) Trans-acting T-cell-specific transcription factor GATA-3| (GATA-binding factor 3) Length = 443 Score = 30.4 bits (67), Expect = 2.1 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAKN-PTWASVTYGVFLCIDCSAVHRSLG 356 K RS ++ + C +C A + P W G +LC C H+ G Sbjct: 253 KARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNG 295
>GATA3_XENLA (P23773) GATA-binding factor 3 (Transcription factor xGATA-3)| Length = 435 Score = 30.4 bits (67), Expect = 2.1 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAKN-PTWASVTYGVFLCIDCSAVHRSLG 356 K RS ++ + C +C A + P W G +LC C H+ G Sbjct: 246 KTRSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNG 288
>GATA2_RAT (Q924Y4) Endothelial transcription factor GATA-2 (GATA-binding| protein 2) Length = 480 Score = 30.0 bits (66), Expect = 2.8 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAK-NPTWASVTYGVFLCIDCSAVHRSLG 356 K RS S+ + C +C A P W G +LC C H+ G Sbjct: 285 KARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNG 327
>GATA2_MOUSE (O09100) Endothelial transcription factor GATA-2 (GATA-binding| protein 2) Length = 480 Score = 30.0 bits (66), Expect = 2.8 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAK-NPTWASVTYGVFLCIDCSAVHRSLG 356 K RS S+ + C +C A P W G +LC C H+ G Sbjct: 285 KARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNG 327
>GATA2_HUMAN (P23769) Endothelial transcription factor GATA-2 (GATA-binding| protein 2) Length = 480 Score = 30.0 bits (66), Expect = 2.8 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAK-NPTWASVTYGVFLCIDCSAVHRSLG 356 K RS S+ + C +C A P W G +LC C H+ G Sbjct: 285 KARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNG 327
>GATA2_CHICK (P23824) GATA-binding factor 2 (GATA-2) (Transcription factor| NF-E1B) Length = 466 Score = 30.0 bits (66), Expect = 2.8 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAK-NPTWASVTYGVFLCIDCSAVHRSLG 356 K RS S+ + C +C A P W G +LC C H+ G Sbjct: 271 KARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNG 313
>GATA5_CHICK (P43692) Transcription factor GATA-5 (GATA-binding factor 5)| Length = 391 Score = 29.6 bits (65), Expect = 3.6 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +3 Query: 213 RSSVFRKLRS-KSDNKMCFDCNAKN-PTWASVTYGVFLCIDCSAVHRSLGVH 362 R S F L D + C +C A + P W G +LC C H+ G++ Sbjct: 169 RRSTFEYLEEFPGDGRECVNCGAMSTPLWRKDGTGHYLCNACGLYHKMNGIN 220
>GATA2_XENLA (P23770) GATA-binding factor 2 (GATA-2) (Transcription factor| xGATA-2) Length = 452 Score = 29.6 bits (65), Expect = 3.6 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 231 KLRSKSDNKMCFDCNAK-NPTWASVTYGVFLCIDCSAVHRSLG 356 K RS S+ + C +C A P W G +LC C H+ G Sbjct: 257 KSRSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNG 299
>SRBP1_RAT (P56720) Sterol regulatory element-binding protein 1 (SREBP-1)| (Sterol regulatory element-binding transcription factor 1) (Adipocyte determination- and differentiation-dependent factor 1) (ADD1) (Fragment) Length = 1024 Score = 29.6 bits (65), Expect = 3.6 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +3 Query: 258 MCFDCNAKNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMMVYGGN 437 + F C NP + +G+ D S VHRS G + S + +WT L +V+ N Sbjct: 459 LVFLCLTCNPLASLFGWGILTPSDASGVHRSSGRSMLEAESRDGSNWTQWLLPPLVWLAN 518
>GATA5_HUMAN (Q9BWX5) Transcription factor GATA-5 (GATA-binding factor 5)| Length = 397 Score = 28.9 bits (63), Expect = 6.2 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 249 DNKMCFDCNA-KNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVR 377 + + C +C A P W G +LC C H+ GV+ VR Sbjct: 185 EGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVR 228
>XYNA_STRLI (P26514) Endo-1,4-beta-xylanase A precursor (EC 3.2.1.8) (Xylanase| A) (1,4-beta-D-xylan xylanohydrolase A) Length = 477 Score = 28.9 bits (63), Expect = 6.2 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +3 Query: 288 TWASVTYGVFLCIDCSAVHRSLGVHVSFVRSTNLDSWTPEQLKMM 422 T+A+VT DC AV R LG+ V VR + DSW EQ ++ Sbjct: 287 TYANVTN------DCLAVSRCLGITVWGVRDS--DSWRSEQTPLL 323
>GATA5_MOUSE (P97489) Transcription factor GATA-5 (GATA-binding factor 5)| Length = 404 Score = 28.9 bits (63), Expect = 6.2 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 249 DNKMCFDCNA-KNPTWASVTYGVFLCIDCSAVHRSLGVHVSFVR 377 + + C +C A P W G +LC C H+ GV+ VR Sbjct: 192 EGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVR 235
>GATA4_HUMAN (P43694) Transcription factor GATA-4 (GATA-binding factor 4)| Length = 442 Score = 28.5 bits (62), Expect = 8.1 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +3 Query: 246 SDNKMCFDCNAKN-PTWASVTYGVFLCIDCSAVHRSLGVHVSFVR 377 S+ + C +C A + P W G +LC C H+ G++ ++ Sbjct: 212 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIK 256
>GATA4_RAT (P46152) Transcription factor GATA-4 (GATA-binding factor 4)| (DNA-binding protein GATA-GT2) Length = 440 Score = 28.5 bits (62), Expect = 8.1 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +3 Query: 246 SDNKMCFDCNAKN-PTWASVTYGVFLCIDCSAVHRSLGVHVSFVR 377 S+ + C +C A + P W G +LC C H+ G++ ++ Sbjct: 211 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIK 255
>GATA4_MOUSE (Q08369) Transcription factor GATA-4 (GATA-binding factor 4)| Length = 440 Score = 28.5 bits (62), Expect = 8.1 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +3 Query: 246 SDNKMCFDCNAKN-PTWASVTYGVFLCIDCSAVHRSLGVHVSFVR 377 S+ + C +C A + P W G +LC C H+ G++ ++ Sbjct: 211 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIK 255
>GATA4_XENLA (Q91677) GATA-binding factor 4 (Transcription factor xGATA-4)| Length = 392 Score = 28.5 bits (62), Expect = 8.1 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +3 Query: 246 SDNKMCFDCNAKN-PTWASVTYGVFLCIDCSAVHRSLGVHVSFVR 377 S+ + C +C A + P W G +LC C H+ G++ ++ Sbjct: 179 SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIK 223 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,837,086 Number of Sequences: 219361 Number of extensions: 573899 Number of successful extensions: 1603 Number of sequences better than 10.0: 79 Number of HSP's better than 10.0 without gapping: 1559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1593 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)