| Clone Name | baet93h07 |
|---|---|
| Clone Library Name | barley_pub |
>EA92_VICFA (P21747) Embryonic abundant protein USP92 precursor| Length = 268 Score = 37.7 bits (86), Expect = 0.011 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 136 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 252 +L+ +A VG A + YW+S PNTP+P + S LL Sbjct: 8 VLSLFCLAFVGITATSSEEDYWQSIWPNTPLPKTFSDLL 46
>EA30_VICFA (P21745) Embryonic abundant protein VF30.1 precursor| Length = 268 Score = 37.4 bits (85), Expect = 0.014 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 136 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 252 +L+ +A VG A + YW+S PNTP+P + S LL Sbjct: 8 VLSLFCLAFVGITATSSGEDYWQSIWPNTPLPKTFSDLL 46
>RD22_ARATH (Q08298) Dehydration-responsive protein RD22 precursor| Length = 392 Score = 37.0 bits (84), Expect = 0.019 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +1 Query: 118 RLVAAGILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 252 RL +L ++ ++ A P +YW +ALPNTP+P+SL LL Sbjct: 4 RLPLICLLGSFMVVAIA--ADLTPERYWSTALPNTPIPNSLHNLL 46
>SVF30_VICFA (P09059) Unknown seed protein 30.1 precursor (VF30.1)| Length = 268 Score = 35.8 bits (81), Expect = 0.042 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 136 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQL 249 +L+ +A VG A + YW+S PNTP+P + S L Sbjct: 8 VLSLFCLAFVGITATSSGEDYWQSIWPNTPLPKTFSDL 45
>EA87_VICFA (P21746) Embryonic abundant protein USP87 precursor| Length = 268 Score = 35.8 bits (81), Expect = 0.042 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 136 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 252 +L+ +A VG A YW+S PNTP+P + S +L Sbjct: 8 VLSLFCLAFVGITATSPREDYWQSIWPNTPLPKTFSDML 46
>PPSA_MYCTU (Q10977) Phenolpthiocerol synthesis polyketide synthase ppsA| Length = 1876 Score = 31.2 bits (69), Expect = 1.0 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 127 AAGILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLLDTQ 261 AAGI F+ H P Q++E+A P+ P +++DTQ Sbjct: 452 AAGIAGFIKTVLAVQHGQIPPNQHFETANPHIPFTDLRMKVVDTQ 496
>KLK9_HUMAN (Q9UKQ9) Kallikrein-9 precursor (EC 3.4.21.-) (Kallikrein-like| protein 3) (KLK-L3) Length = 250 Score = 30.8 bits (68), Expect = 1.4 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -1 Query: 175 HGFLPTRSVGRQECRLRRAYPWRAG 101 HG+ TR++G +ECR + PW+AG Sbjct: 16 HGWADTRAIGAEECR-PNSQPWQAG 39
>GID_DEIRA (Q9RXU7) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 465 Score = 29.3 bits (64), Expect = 3.9 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = -2 Query: 420 ADADRSPAGLGAARLHVDADATLAHIDRRAPRHP 319 ADA R PAG A VD DA AH+ + HP Sbjct: 84 ADASRVPAGNALA---VDRDAFSAHVTEQVKNHP 114
>OSP4_PEA (P17771) Organ-specific protein P4| Length = 130 Score = 28.9 bits (63), Expect = 5.1 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +1 Query: 136 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLLD 255 + FL++A+V S + G+YW+ + + MP + LLD Sbjct: 13 LFLFLIVANVESR--KDVGEYWKLVMKDQDMPEEIQGLLD 50
>AMPD2_HUMAN (Q01433) AMP deaminase 2 (EC 3.5.4.6) (AMP deaminase isoform L)| Length = 879 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 145 RQECRLRRAYPWRAGQRAAMRKLTAGPSQCEDD 47 R C L ++ P AG+R + GPS+C D Sbjct: 12 RSRCFLHQSLPLGAGRRKGLDVAEPGPSRCRSD 44
>ADA15_RAT (Q9QYV0) ADAM 15 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 15) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metalloprotease RGD disintegrin protein) (Metargidin) (CRII-7) Length = 816 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 135 HSCLPTDRVGRKPC-SSCSGAILGVC-SSQHSH 227 H C P D +G + C S C G GVC SS+H H Sbjct: 646 HRCQPVDLLGAQECRSKCHGH--GVCDSSRHCH 676
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 28.1 bits (61), Expect = 8.8 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -3 Query: 320 PWPASTWTPPEPTFTDVPPA 261 P P+ T++PP PT++ PP+ Sbjct: 276 PQPSPTYSPPPPTYSPPPPS 295 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,262,036 Number of Sequences: 219361 Number of extensions: 883090 Number of successful extensions: 1999 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1994 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)