| Clone Name | baet93h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | QUTG_EMENI (P25416) Protein qutG | 32 | 0.39 | 2 | MOC_ORYSA (Q84MM9) Protein MONOCULM 1 | 28 | 5.7 |
|---|
>QUTG_EMENI (P25416) Protein qutG| Length = 330 Score = 32.0 bits (71), Expect = 0.39 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -1 Query: 337 SSLLRRGADAEAQLDELPSVREPTFPVAPATKTRSCSF 224 SS L RGA ++ +LP +R+P+ P PAT C F Sbjct: 142 SSCLNRGAWLN-EMQQLPLIRKPSIPPLPATAPSKCIF 178
>MOC_ORYSA (Q84MM9) Protein MONOCULM 1| Length = 441 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 Query: 124 WYPHLRDLRADAEHASGPLPPATRHRGSGAERDT 23 W P L+ + A+ A GP P R G+GA+RDT Sbjct: 171 WPPLLQAIAERADPALGP--PEVRVTGAGADRDT 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,379,016 Number of Sequences: 219361 Number of extensions: 289795 Number of successful extensions: 958 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)