| Clone Name | baet93d09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UPTG1_SOLTU (Q9SC19) Alpha-1,4-glucan-protein synthase [UDP-form... | 86 | 2e-17 | 2 | UPTG_PEA (O04300) Alpha-1,4-glucan-protein synthase [UDP-forming... | 85 | 5e-17 | 3 | UPTG_MAIZE (P80607) Alpha-1,4-glucan-protein synthase [UDP-formi... | 85 | 6e-17 | 4 | UPTG2_SOLTU (Q8RU27) Alpha-1,4-glucan-protein synthase [UDP-form... | 84 | 8e-17 |
|---|
>UPTG1_SOLTU (Q9SC19) Alpha-1,4-glucan-protein synthase [UDP-forming] 1 (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase 1) (UPTG 1) Length = 365 Score = 86.3 bits (212), Expect = 2e-17 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +1 Query: 1 FNTLYDPYREGADFVRGYPFSLREGAPTAVSHGLWLNIP 117 FNTLYDPYR+GADFVRGYPFS+REGAPTAVSHGLWLNIP Sbjct: 133 FNTLYDPYRDGADFVRGYPFSMREGAPTAVSHGLWLNIP 171
>UPTG_PEA (O04300) Alpha-1,4-glucan-protein synthase [UDP-forming] (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase) (UPTG) (Reversibly glycosylated polypeptide) Length = 364 Score = 85.1 bits (209), Expect = 5e-17 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +1 Query: 1 FNTLYDPYREGADFVRGYPFSLREGAPTAVSHGLWLNIP 117 FNTLYDPYREG DFVRGYPFSLREG PTAVSHGLWLNIP Sbjct: 136 FNTLYDPYREGTDFVRGYPFSLREGVPTAVSHGLWLNIP 174
>UPTG_MAIZE (P80607) Alpha-1,4-glucan-protein synthase [UDP-forming] (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase) (UPTG) (Amylogenin) (Golgi-associated protein se-wap41) Length = 364 Score = 84.7 bits (208), Expect = 6e-17 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +1 Query: 1 FNTLYDPYREGADFVRGYPFSLREGAPTAVSHGLWLNIP 117 FNTLYDPYREGADFVRGYPFSLREGA TAVSHGLWLNIP Sbjct: 143 FNTLYDPYREGADFVRGYPFSLREGAHTAVSHGLWLNIP 181
>UPTG2_SOLTU (Q8RU27) Alpha-1,4-glucan-protein synthase [UDP-forming] 2 (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase 2) (UPTG 2) Length = 366 Score = 84.3 bits (207), Expect = 8e-17 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +1 Query: 1 FNTLYDPYREGADFVRGYPFSLREGAPTAVSHGLWLNIP 117 FNTLYDPYREGADFVRGYPFS+REGA TAVSHGLWLNIP Sbjct: 137 FNTLYDPYREGADFVRGYPFSMREGAATAVSHGLWLNIP 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,758,538 Number of Sequences: 219361 Number of extensions: 243689 Number of successful extensions: 683 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 683 length of database: 80,573,946 effective HSP length: 15 effective length of database: 77,283,531 effective search space used: 1854804744 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)