| Clone Name | baet93c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHIT1_TULBA (Q9SLP4) Chitinase 1 precursor (EC 3.2.1.14) (Tulip ... | 42 | 4e-04 | 2 | CHIT2_TULBA (Q7M443) Chitinase 2 (EC 3.2.1.14) (Tulip bulb chiti... | 42 | 6e-04 | 3 | ILVC_TREPR (Q8KTR6) Ketol-acid reductoisomerase (EC 1.1.1.86) (A... | 30 | 2.3 | 4 | RL3_GEOSL (P60454) 50S ribosomal protein L3 | 28 | 8.6 | 5 | RPOC_NITEU (Q82T76) DNA-directed RNA polymerase beta' chain (EC ... | 28 | 8.6 |
|---|
>CHIT1_TULBA (Q9SLP4) Chitinase 1 precursor (EC 3.2.1.14) (Tulip bulb| chitinase-1) (TBC-1) Length = 314 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = +3 Query: 108 IAMTNGYLFREYIGAQFTGVRFSDVPVNTGV 200 + +T+ +FREYIG+QF V+FSDVP+N V Sbjct: 21 LPLTSALVFREYIGSQFNDVKFSDVPINPDV 51
>CHIT2_TULBA (Q7M443) Chitinase 2 (EC 3.2.1.14) (Tulip bulb chitinase-2) (TBC-2)| Length = 275 Score = 41.6 bits (96), Expect = 6e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = +3 Query: 129 LFREYIGAQFTGVRFSDVPVNTGV 200 LFREYIGAQF V+FSDVP+N V Sbjct: 2 LFREYIGAQFNDVKFSDVPINPNV 25
>ILVC_TREPR (Q8KTR6) Ketol-acid reductoisomerase (EC 1.1.1.86)| (Acetohydroxy-acid isomeroreductase) (Alpha-keto-beta-hydroxylacil reductoisomerase) Length = 328 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +3 Query: 33 RSHCIYQQQSGVPLILTPRPAPARSIAMTNGYLFR 137 R+H + + SGV +++ RP P+ AM++G++ R Sbjct: 29 RAHAMNLRDSGVEVVIGLRPGPSFDAAMSDGFMPR 63
>RL3_GEOSL (P60454) 50S ribosomal protein L3| Length = 210 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +2 Query: 14 QQARLITEPL--HISAAEWGAFDPHTEASSSSIDRHD 118 Q+AR +T+P+ HI AA GAF E +DR++ Sbjct: 56 QEARKVTKPMLGHIKAAGQGAFAHIREFRLDDVDRYN 92
>RPOC_NITEU (Q82T76) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1404 Score = 27.7 bits (60), Expect = 8.6 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = +3 Query: 30 LRSHCIYQQQSGVPLILTPRPAPARSIAMTNGYLFREYIGAQFTGVRFSDV 182 L ++ + +G P+I+ P++ I + Y+ R+ IGAQ G+ FSD+ Sbjct: 485 LSTNNVLSPANGDPIIV-----PSQDIVLGLYYMTRKKIGAQGEGMVFSDI 530 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,764,968 Number of Sequences: 219361 Number of extensions: 460171 Number of successful extensions: 1453 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1452 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)