| Clone Name | baet91g05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHRD_XENLA (Q91713) Chordin precursor (Organizer-specific secret... | 29 | 3.8 | 2 | GPR45_HUMAN (Q9Y5Y3) Probable G-protein coupled receptor 45 (PSP... | 28 | 8.6 | 3 | GPR45_MOUSE (Q9EQQ4) Probable G-protein coupled receptor 45 (PSP... | 28 | 8.6 |
|---|
>CHRD_XENLA (Q91713) Chordin precursor (Organizer-specific secreted dorsalizing| factor) Length = 941 Score = 29.3 bits (64), Expect = 3.8 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 125 CASPLLLSRSCCCTC-ASPLPNLSTSD 48 CA+P+LL CC TC +P P + SD Sbjct: 102 CANPILLPLHCCKTCPKAPPPPIKKSD 128
>GPR45_HUMAN (Q9Y5Y3) Probable G-protein coupled receptor 45 (PSP24-alpha)| (PSP24-1) Length = 372 Score = 28.1 bits (61), Expect = 8.6 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = -3 Query: 150 PTRSTARRLCLAIAAFSQLLLHLC---FTASEPLNERW 46 P +A L LA AFS ++L LC FTA + RW Sbjct: 63 PAMRSAINLLLATLAFSDIMLSLCCMPFTAVTLITVRW 100
>GPR45_MOUSE (Q9EQQ4) Probable G-protein coupled receptor 45 (PSP24-alpha)| (PSP24-1) Length = 373 Score = 28.1 bits (61), Expect = 8.6 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = -3 Query: 150 PTRSTARRLCLAIAAFSQLLLHLC---FTASEPLNERW 46 P +A L LA AFS ++L LC FTA + RW Sbjct: 63 PAMRSAINLLLATLAFSDIMLSLCCMPFTAITLITVRW 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,783,113 Number of Sequences: 219361 Number of extensions: 316619 Number of successful extensions: 1146 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1146 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)