ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet91e06 |
|---|---|
| Clone Library Name | barley_pub |
>CB4_SPIOL (P36494) Chlorophyll a-b binding protein CP24, chloroplast| precursor Length = 261 Score = 78.6 bits (192), Expect = 3e-15 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +1 Query: 244 KKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDPAF 366 KKSWIPA K F++P WLDGSLPGDFGFDPLGLGKDPAF Sbjct: 57 KKSWIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAF 97
>CB4B_LYCES (P27525) Chlorophyll a-b binding protein CP24 10B, chloroplast| precursor (CAB-10B) (LHCP) Length = 256 Score = 78.2 bits (191), Expect = 5e-15 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +1 Query: 244 KKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDPAF 366 KKSWIPA KS ++P WLDGSLPGDFGFDPLGLGKDPAF Sbjct: 52 KKSWIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAF 92
>CB4A_LYCES (P27524) Chlorophyll a-b binding protein CP24 10A, chloroplast| precursor (CAB-10A) (LHCP) Length = 256 Score = 74.3 bits (181), Expect = 7e-14 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 244 KKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDPAF 366 KKSWIPA + ++P WLDGSLPGD+GFDPLGLGKDPAF Sbjct: 52 KKSWIPAVRGGGNLVDPEWLDGSLPGDYGFDPLGLGKDPAF 92
>CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast precursor| (LHCI type II CAB) Length = 270 Score = 53.5 bits (127), Expect = 1e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 D+ W P P WLDGSLPGDFGFDPLGLG DP Sbjct: 64 DRPLWFPGSTP------PEWLDGSLPGDFGFDPLGLGSDP 97
>CB12_LYCES (P10708) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCI type II CAB-7) Length = 270 Score = 50.8 bits (120), Expect = 8e-07 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 D+ W P P WLDGSLPGDFGFDPLGL DP Sbjct: 64 DRPLWFPGSTP------PPWLDGSLPGDFGFDPLGLASDP 97
>CB4A_ARATH (Q07473) Chlorophyll a-b binding protein CP29.1, chloroplast| precursor (LHCII protein 4.1) (LHCB4.1) Length = 290 Score = 48.1 bits (113), Expect = 5e-06 Identities = 22/52 (42%), Positives = 27/52 (51%) Frame = +1 Query: 199 KPVTRRXXXXXXXXDKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGK 354 K ++ D+ W P I+P WLDGSL GD+GFDP GLGK Sbjct: 40 KAAPKKSAKKTVTTDRPLWYPGA------ISPDWLDGSLVGDYGFDPFGLGK 85
>CB4B_ARATH (Q9XF88) Chlorophyll a-b binding protein CP29.2, chloroplast| precursor (LHCII protein 4.2) (LHCB4.2) Length = 287 Score = 45.1 bits (105), Expect = 4e-05 Identities = 21/38 (55%), Positives = 24/38 (63%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGK 354 D+ W P KS P +LDGSL GD+GFDP GLGK Sbjct: 51 DRPLWFPGAKS------PEYLDGSLVGDYGFDPFGLGK 82
>CB29_CHLRE (Q93WD2) Chlorophyll a-b binding protein CP29| Length = 279 Score = 45.1 bits (105), Expect = 4e-05 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDPAF 366 P WLDGSLPGD GFDPLGL K F Sbjct: 59 PEWLDGSLPGDRGFDPLGLSKPSEF 83
>CB11_LYCES (P12360) Chlorophyll a-b binding protein 6A, chloroplast precursor| (LHCI type I CAB-6A) (Light-harvesting complex I 26 kDa protein) Length = 246 Score = 44.3 bits (103), Expect = 7e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDPA 363 PS+LDGS PGDFGFD LGLG+ PA Sbjct: 56 PSYLDGSAPGDFGFDSLGLGEVPA 79
>CB24_ARATH (P27521) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCI type III CAB-4) (LHCP) Length = 251 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/39 (51%), Positives = 23/39 (58%) Frame = +1 Query: 244 KKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 K W+P S P +L GSL GD GFDPLGL +DP Sbjct: 54 KGEWLPGLAS------PDYLTGSLAGDNGFDPLGLAEDP 86
>CB4C_ARATH (Q9S7W1) Chlorophyll a-b binding protein CP29.3, chloroplast| precursor (LHCII protein 4.3) (LHCB4.3) Length = 276 Score = 41.2 bits (95), Expect = 6e-04 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = +1 Query: 202 PVTRRXXXXXXXXDKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGK 354 P ++ D+ W P P WLDGS+ GD GFDP GLGK Sbjct: 42 PPPKKSRQVQDDGDRLVWFPGANP------PEWLDGSMIGDRGFDPFGLGK 86
>CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCI type III CAB-8) Length = 273 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +1 Query: 295 SWLDGSLPGDFGFDPLGLGKDPAFSSG 375 S+LDG LPGDFGFDPLGL DP + G Sbjct: 64 SYLDGRLPGDFGFDPLGL-SDPEGTGG 89
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 38.1 bits (87), Expect = 0.005 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 D++ ++P D I P +L+G + GD+G+DP GLGK P Sbjct: 66 DRRIFLPDGLLDRSEI-PEYLNGEVAGDYGYDPFGLGKKP 104
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDPA 363 D+ ++ F +A PS+L G PGD+G+D GL DPA Sbjct: 54 DRVKYLGPFSGEA----PSYLTGEFPGDYGWDTAGLSADPA 90
>LH18_EUGGR (P08976) Light-harvesting complex I LH38 proteins precursor| [Contains: LH38 protein 1; LH38 protein 2; LH38 protein 3] (Fragment) Length = 530 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PSWL+G GD GFDP GL DP Sbjct: 12 PSWLNGEYYGDRGFDPAGLAADP 34 Score = 32.7 bits (73), Expect = 0.22 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 +++ W P + P +L G GD GFDP GL DP Sbjct: 370 ERELWFP------NIVPPRYLTGEAYGDKGFDPAGLAADP 403 Score = 31.2 bits (69), Expect = 0.63 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 P+ L G P D GFDPL L DP Sbjct: 197 PALLTGEYPADRGFDPLNLAADP 219
>CB2_CHLMO (P22686) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 256 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 D+ W+ F ++ P++L G PGD+G+D GL DP Sbjct: 43 DRAKWLGPFSTNT----PAYLTGEFPGDYGWDTAGLSADP 78
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 36.6 bits (83), Expect = 0.015 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = +1 Query: 199 KPVTRRXXXXXXXXDKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 KP T + D+ ++ F ++ PS+L G PGD+G+D GL DP Sbjct: 41 KPKTVQSSSPWYGPDRVKYLGPFSGES----PSYLTGEFPGDYGWDTAGLSADP 90
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 35.8 bits (81), Expect = 0.026 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 D+ ++ F +A PS+L G PGD+G+D GL DP Sbjct: 54 DRVKYLGPFSGEA----PSYLTGEFPGDYGWDTAGLSADP 89
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 35.8 bits (81), Expect = 0.026 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 D+ ++ F +A PS+L G PGD+G+D GL DP Sbjct: 52 DRVKYLGPFSGEA----PSYLTGEFPGDYGWDTAGLSADP 87
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 35.8 bits (81), Expect = 0.026 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 D+ ++ F +A PS+L G PGD+G+D GL DP Sbjct: 55 DRVKYLGPFSGEA----PSYLTGEFPGDYGWDTAGLSADP 90
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 35.8 bits (81), Expect = 0.026 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 D+ ++ F +A PS+L G PGD+G+D GL DP Sbjct: 55 DRVKYLGPFSGEA----PSYLTGEFPGDYGWDTAGLSADP 90
>CB2_CHLRE (P14273) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 35.4 bits (80), Expect = 0.034 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 ++ W+ + +A P++L G PGD+G+D GL DP Sbjct: 40 NRAKWLGPYSENA---TPAYLTGEFPGDYGWDTAGLSADP 76
>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,| chloroplast precursor (CAB) Length = 268 Score = 35.0 bits (79), Expect = 0.044 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L+G PGD+G+D GL DP Sbjct: 67 PSYLNGEFPGDYGWDTAGLSADP 89
>CB23_LYCES (P27489) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type III CAB-13) Length = 265 Score = 35.0 bits (79), Expect = 0.044 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L+G PGD+G+D GL DP Sbjct: 64 PSYLNGEFPGDYGWDTAGLSADP 86
>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I| CAB-AB96) (LHCP) (Major 15) (Fragment) Length = 228 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 28 SPSYLTGEFPGDYGWDTAGLSADP 51
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 66 SPSYLTGEFPGDYGWDTAGLSADP 89
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 66 SPSYLTGEFPGDYGWDTAGLSADP 89
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 69 SPSYLTGEFPGDYGWDTAGLSADP 92
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 64 SPSYLTGEFPGDYGWDTAGLSADP 87
>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 264 Score = 34.7 bits (78), Expect = 0.057 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 259 PAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 P F PS+L G PGD+G+D GL DP Sbjct: 54 PKFLGPFSEQTPSYLTGEFPGDYGWDTAGLSADP 87
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 67 SPSYLTGEFPGDYGWDTAGLSADP 90
>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCII type I CAB-8) Length = 268 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 68 SPSYLTGEFPGDYGWDTAGLSADP 91
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 67 SPSYLTGEFPGDYGWDTAGLSADP 90
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 67 SPSYLTGEFPGDYGWDTAGLSADP 90
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 67 SPSYLTGEFPGDYGWDTAGLSADP 90
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 66 SPSYLTGEFPGDYGWDTAGLSADP 89
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 66 SPSYLTGEFPGDYGWDTAGLSADP 89
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 65 SPSYLTGEFPGDYGWDTAGLSADP 88
>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,| chloroplast precursor (DE Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP) Length = 265 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 66 PSYLSGEFPGDYGWDTAGLSADP 88
>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor| (LHCII type I CAB-21) (LHCP) Length = 265 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 289 NPSWLDGSLPGDFGFDPLGLGKDP 360 +PS+L G PGD+G+D GL DP Sbjct: 65 SPSYLTGEFPGDYGWDTAGLSADP 88
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 67 PSYLTGEFPGDYGWDTAGLSADP 89
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 66 PSYLTGEFPGDYGWDTAGLSADP 88
>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 262 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 63 PSYLTGEFPGDYGWDTAGLSADP 85
>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,| chloroplast precursor (Chlorophyll a-b binding protein type II 1B) (CAB) (LHCP) Length = 274 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 75 PSYLTGEFPGDYGWDTAGLSADP 97
>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 245 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 46 PSYLTGEFPGDYGWDTAGLSADP 68
>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) (Fragment) Length = 255 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 56 PSYLTGEFPGDYGWDTAGLSADP 78
>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor| (LHCII type I CAB-3) (LHCP) Length = 263 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 64 PSYLTGEFPGDYGWDTAGLSADP 86
>CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 263 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 64 PSYLTGEFPGDYGWDTAGLSADP 86
>CB21_SILPR (P12332) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 205 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 65 PSYLTGEFPGDYGWDTAGLSADP 87
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 62 PSYLTGEFPGDYGWDTAGLSADP 84
>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type II CAB-1A) (LHCP) Length = 278 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 79 PSYLTGEFPGDYGWDTAGLSADP 101
>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,| chloroplast precursor (Chlorophyll a-b binding protein type II 1A) (CAB) (LHCP) Length = 278 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 79 PSYLTGEFPGDYGWDTAGLSADP 101
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 66 PSYLTGEFPGDYGWDTAGLSADP 88
>CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloroplast precursor| (LHCII type I CAB-37) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 66 PSYLTGEFPGDYGWDTAGLSADP 88
>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCII type I CAB-4) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 66 PSYLTGEFPGDYGWDTAGLSADP 88
>CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloroplast precursor| (LHCII type I CAB-36) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 66 PSYLTGEFPGDYGWDTAGLSADP 88
>CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloroplast precursor| (LHCII type II CAB-215) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 66 PSYLTGEFPGDYGWDTAGLSADP 88
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 66 PSYLTGEFPGDYGWDTAGLSADP 88
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 66 PSYLTGEFPGDYGWDTAGLSADP 88
>CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chloroplast precursor| (LHCII type II CAB-151) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 66 PSYLTGEFPGDYGWDTAGLSADP 88
>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor| (LHCII type I CAB-5) (LHCP) (Fragment) Length = 237 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 38 PSYLTGEFPGDYGWDTAGLSADP 60
>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 206 Score = 34.3 bits (77), Expect = 0.075 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 7 PSYLTGEFPGDYGWDTAGLSADP 29
>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor| (LHCII type I CAB-48) (LHCP) Length = 264 Score = 33.5 bits (75), Expect = 0.13 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL DP Sbjct: 65 PSYLTGEFPGDYGWDTEGLSADP 87 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 Query: 280 EFINPSWLDGSLPGDFGFDPLGLGKDP 360 E ++P +L GS FDPLGLG DP Sbjct: 182 EVVDPLYLGGS------FDPLGLGDDP 202
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 33.5 bits (75), Expect = 0.13 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 D+ ++ F +A PS+L G P D+G+D GL DP Sbjct: 55 DRVKYLGPFSGEA----PSYLTGEFPSDYGWDTAGLSADP 90
>CB2_PHYPA (P20866) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 269 Score = 32.7 bits (73), Expect = 0.22 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 259 PAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 P F PS+L+G GD+G+D GL DP Sbjct: 58 PKFLGPFSGETPSYLNGEFAGDYGWDTAGLSSDP 91
>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor| (LHCII type I CAB-91R) (LHCP) Length = 267 Score = 32.7 bits (73), Expect = 0.22 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 241 DKKSWIPAFKSDAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 D+ ++ F +A PS+L G PGD+G+D L DP Sbjct: 55 DRVKYLGPFSGEA----PSYLTGEFPGDYGWDTAELSADP 90
>CB2_DUNTE (P27517) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 32.7 bits (73), Expect = 0.22 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 P +L G PGD+G+D GL DP Sbjct: 51 PEYLTGEFPGDYGWDTAGLSADP 73
>CB21_PINTH (P10049) Chlorophyll a-b binding protein type I, chloroplast| precursor (CAB) (LHCP) Length = 266 Score = 30.8 bits (68), Expect = 0.83 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D + DP Sbjct: 67 PSYLTGEFPGDYGWDTAAVSADP 89
>CB2_MALDO (P15773) Chlorophyll a-b binding protein AB10, chloroplast| precursor (LHCII type I CAB-AB10) (LHCP) Length = 268 Score = 30.8 bits (68), Expect = 0.83 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 PS+L G PGD+G+D GL P Sbjct: 70 PSYLTGEFPGDYGWDTAGLSAYP 92
>LH15_EUGGR (P08975) Light-harvesting complex I LH35 proteins precursor| [Contains: LH35 protein 1; LH35 protein 2] (Fragment) Length = 331 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 292 PSWLDGSLPGDFGFDPLGLGKDP 360 P+ L G P D GFDPL + DP Sbjct: 169 PAHLTGEYPADRGFDPLSVAADP 191
>CB2_DUNSA (P20865) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 273 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 274 DAEFINPSWLDGSLPGDFGFDPLGLGKDP 360 D + +P G PGD+G+D GL DP Sbjct: 67 DLQHQHPRLPTGEFPGDYGWDTAGLSADP 95
>FCP_ISOGA (Q39709) Fucoxanthin-chlorophyll a-c binding protein, chloroplast| precursor (FCP) Length = 208 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/20 (65%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +1 Query: 304 DGSLPGDFGFDPLGLG-KDP 360 +G PGD GFDPLGL DP Sbjct: 145 EGYEPGDLGFDPLGLAPSDP 164
>PNKP_HUMAN (Q96T60) Bifunctional polynucleotide phosphatase/kinase| (Polynucleotide kinase-3'-phosphatase) (DNA 5'-kinase/3'-phosphatase) [Includes: Polynucleotide 3'-phosphatase (EC 3.1.3.32) (2'(3')-polynucleotidase); Polynucleotide 5'-hydroxyl-kinase ( Length = 521 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -2 Query: 363 RRVLAKPQGVEAEVTGERAIEPGRVDELGIAFERGDPRLLVGG 235 R V K GV TG + ++PG LG+ GD LV G Sbjct: 60 RTVAVKQLGVNPSTTGTQELKPGLEGSLGV----GDTLYLVNG 98 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,260,136 Number of Sequences: 219361 Number of extensions: 404622 Number of successful extensions: 1461 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 1387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1460 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
