| Clone Name | baet91d01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IDGF4_DROME (Q9W303) Chitinase-like protein Idgf4 precursor (Ima... | 30 | 3.1 | 2 | TF7L1_MOUSE (Q9Z1J1) Transcription factor 7-like 1 (HMG box tran... | 29 | 6.8 |
|---|
>IDGF4_DROME (Q9W303) Chitinase-like protein Idgf4 precursor (Imaginal disk| growth factor protein 4) Length = 442 Score = 30.0 bits (66), Expect = 3.1 Identities = 21/62 (33%), Positives = 27/62 (43%) Frame = +1 Query: 67 RLTHSHGLTPLRPLSLTRSVRLRPAGSPRRXXXXXXXXXXVPKLPGPNLHHPSGRYGPLV 246 +LT GLT L P++ V PAG+ + KLP P H G GPL Sbjct: 305 KLTKDSGLTGLPPVAEADGVA--PAGTQTQIPGLLSWPEVCAKLPNPANQHLKGADGPLR 362 Query: 247 RV 252 +V Sbjct: 363 KV 364
>TF7L1_MOUSE (Q9Z1J1) Transcription factor 7-like 1 (HMG box transcription| factor 3) (TCF-3) (mTCF-3) Length = 584 Score = 28.9 bits (63), Expect = 6.8 Identities = 20/77 (25%), Positives = 31/77 (40%), Gaps = 4/77 (5%) Frame = +1 Query: 25 SVRPTKKPKSSFVSR----LTHSHGLTPLRPLSLTRSVRLRPAGSPRRXXXXXXXXXXVP 192 +V+ T+ P + +S + H H + PL PL + PA P +P Sbjct: 160 TVKDTRSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNDHFSPASPPTHLSPEIDPKTGIP 219 Query: 193 KLPGPNLHHPSGRYGPL 243 + P P+ P Y PL Sbjct: 220 RPPHPSELSP---YYPL 233 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,025,335 Number of Sequences: 219361 Number of extensions: 486294 Number of successful extensions: 1296 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1296 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)