| Clone Name | baet90c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UHRF1_RAT (Q7TPK1) Ubiquitin-like PHD and RING finger domain-con... | 30 | 2.4 | 2 | UHRF1_MOUSE (Q8VDF2) Ubiquitin-like PHD and RING finger domain-c... | 30 | 2.4 | 3 | UHRF1_HUMAN (Q96T88) Ubiquitin-like PHD and RING finger domain-c... | 30 | 2.4 | 4 | CO4A2_MOUSE (P08122) Collagen alpha-2(IV) chain precursor | 28 | 5.3 |
|---|
>UHRF1_RAT (Q7TPK1) Ubiquitin-like PHD and RING finger domain-containing| protein 1 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 1) (Liver regeneration-related protein LRRG126) Length = 774 Score = 29.6 bits (65), Expect = 2.4 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 6/39 (15%) Frame = -1 Query: 101 RVVSSKTTDHQPEVAGVHSLSNDDGRS------DEEDVD 3 RV S++ H+P VAG+H SND S E+DVD Sbjct: 430 RVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVD 468
>UHRF1_MOUSE (Q8VDF2) Ubiquitin-like PHD and RING finger domain-containing| protein 1 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 1) (Nuclear zinc finger protein Np95) (Nuclear protein 95) Length = 782 Score = 29.6 bits (65), Expect = 2.4 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 6/39 (15%) Frame = -1 Query: 101 RVVSSKTTDHQPEVAGVHSLSNDDGRS------DEEDVD 3 RV S++ H+P VAG+H SND S E+DVD Sbjct: 438 RVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVD 476
>UHRF1_HUMAN (Q96T88) Ubiquitin-like PHD and RING finger domain-containing| protein 1 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 1) (Inverted CCAAT box-binding protein of 90 kDa) (Transcription factor ICBP90) (Nuclear zinc Length = 793 Score = 29.6 bits (65), Expect = 2.4 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 6/39 (15%) Frame = -1 Query: 101 RVVSSKTTDHQPEVAGVHSLSNDDGRS------DEEDVD 3 RV S++ H+P VAG+H SND S E+DVD Sbjct: 433 RVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVD 471
>CO4A2_MOUSE (P08122) Collagen alpha-2(IV) chain precursor| Length = 1707 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 104 ARVVSSKTTDHQPEVAGVHSLSNDDGRSDEEDVD 3 +R +++K QP + GVH + DDG + +D Sbjct: 545 SRTITTKGERGQPGIPGVHGMKGDDGVPGRDGLD 578 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,521,284 Number of Sequences: 219361 Number of extensions: 175153 Number of successful extensions: 726 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 80,573,946 effective HSP length: 26 effective length of database: 74,870,560 effective search space used: 1796893440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)