| Clone Name | baet81h12 |
|---|---|
| Clone Library Name | barley_pub |
>INVB_DAUCA (P80065) Beta-fructofuranosidase, soluble isoenzyme I precursor (EC| 3.2.1.26) (Sucrose hydrolase) (Invertase) (Saccharase) Length = 661 Score = 52.4 bits (124), Expect = 4e-07 Identities = 22/34 (64%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = +1 Query: 1 YELVPGLLHRVPGTGMWECIDLYPVG--GARGID 96 YEL+ LLH VPGTGMWEC+D YPV G+ G+D Sbjct: 306 YELLDNLLHAVPGTGMWECVDFYPVSVTGSNGLD 339
>INV1_MAIZE (P49175) Beta-fructofuranosidase 1 precursor (EC 3.2.1.26) (Sucrose| 1) (Invertase 1) Length = 670 Score = 49.3 bits (116), Expect = 3e-06 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +1 Query: 1 YELVPGLLHRVPGTGMWECIDLYPVGGARG 90 Y+ P L+H VPGTGMWEC+D YPV G Sbjct: 305 YDPAPALMHAVPGTGMWECVDFYPVAAGSG 334
>INV1_CAPAN (P93761) Acid beta-fructofuranosidase AIV-18 (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) Length = 640 Score = 48.9 bits (115), Expect = 4e-06 Identities = 20/34 (58%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = +1 Query: 1 YELVPGLLHRVPGTGMWECIDLYPVG--GARGID 96 ++L+ G+LH VPGTGMWEC+D YPV A G+D Sbjct: 285 FKLLDGVLHAVPGTGMWECVDFYPVSTLDANGLD 318
>INVA_LYCES (P29000) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 636 Score = 47.4 bits (111), Expect = 1e-05 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = +1 Query: 1 YELVPGLLHRVPGTGMWECIDLYPV 75 ++L+ G+LH VPGTGMWEC+D YPV Sbjct: 280 FKLLDGVLHAVPGTGMWECVDFYPV 304
>INVA_PHAAU (P29001) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) [Contains: Acid beta-fructofuranosidase 30 kDa subunit; Acid beta-fructofuranosidase 38 kDa subunit] Length = 649 Score = 47.0 bits (110), Expect = 2e-05 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = +1 Query: 1 YELVPGLLHRVPGTGMWECIDLYPVGGARG 90 YEL GLL VPGTGMWEC+D +PV G Sbjct: 291 YELKEGLLRAVPGTGMWECVDFFPVSKKNG 320
>INVA_PHAVU (O24509) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 651 Score = 42.7 bits (99), Expect = 3e-04 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +1 Query: 1 YELVPGLLHRVPGTGMWECIDLYPV 75 YEL G L VPGTGMWEC+D +PV Sbjct: 291 YELKNGHLRAVPGTGMWECVDFFPV 315
>INVA_VICFA (Q43857) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 642 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 1 YELVPGLLHRVPGTGMWECIDLYPV 75 YE LL+ VPGTGMWEC+D +PV Sbjct: 283 YERKDMLLNAVPGTGMWECVDFFPV 307
>INV2_DAUCA (Q39692) Beta-fructofuranosidase, insoluble isoenzyme 2 precursor| (EC 3.2.1.26) (Sucrose hydrolase 2) (Invertase 2) (Cell wall beta-fructosidase 2) Length = 592 Score = 35.0 bits (79), Expect = 0.059 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = +1 Query: 22 LHRVPGTGMWECIDLYPVG--GARGID 96 LH TGMWEC+D YPV G G+D Sbjct: 244 LHSKDRTGMWECLDFYPVAPKGMNGLD 270
>INV1_PEA (Q43089) Beta-fructofuranosidase, cell wall isozyme precursor (EC| 3.2.1.26) (Sucrose hydrolase) (Acid invertase) Length = 555 Score = 34.7 bits (78), Expect = 0.077 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +1 Query: 22 LHRVPGTGMWECIDLYPV 75 LH GTGMWEC D YPV Sbjct: 231 LHSAEGTGMWECPDFYPV 248
>INV2_ORYSA (Q56UD4) Beta-fructofuranosidase, insoluble isoenzyme 2 precursor| (EC 3.2.1.26) (Sucrose hydrolase 2) (Invertase 2) (Cell wall beta-fructosidase 2) (OsCIN2) Length = 598 Score = 32.3 bits (72), Expect = 0.38 Identities = 16/28 (57%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = +1 Query: 22 LHRVPGTGMWECIDLYPV---GGARGID 96 LH P TGMWEC D YPV G G+D Sbjct: 240 LHSAP-TGMWECPDFYPVTADGRREGVD 266
>INVA_MAIZE (P49174) Beta-fructofuranosidase, cell wall isozyme precursor (EC| 3.2.1.26) (Sucrose hydrolase) (Invertase) Length = 590 Score = 31.6 bits (70), Expect = 0.65 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 22 LHRVPGTGMWECIDLYPVGG 81 LH TGMWEC D +PV G Sbjct: 239 LHSAALTGMWECPDFFPVSG 258
>INV1_DAUCA (P26792) Beta-fructofuranosidase, insoluble isoenzyme 1 precursor| (EC 3.2.1.26) (Sucrose hydrolase 1) (Invertase 1) (Cell wall beta-fructosidase 1) Length = 592 Score = 31.6 bits (70), Expect = 0.65 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +1 Query: 22 LHRVPGTGMWECIDLYPVG--GARGID 96 +H TGMWEC D +PV G G+D Sbjct: 245 IHSQANTGMWECPDFFPVSLKGLNGLD 271
>INV3_DAUCA (Q39693) Beta-fructofuranosidase, insoluble isoenzyme 3 precursor| (EC 3.2.1.26) (Sucrose hydrolase 3) (Invertase 3) (Cell wall beta-fructosidase 3) Length = 583 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 13 PGLLHRVPGTGMWECIDLYPV 75 P +H TGMWEC D YPV Sbjct: 234 PHPIHTKAETGMWECPDFYPV 254
>INV3_ORYSA (Q56UD3) Beta-fructofuranosidase, insoluble isoenzyme 3 precursor| (EC 3.2.1.26) (Sucrose hydrolase 3) (Invertase 3) (Cell wall beta-fructosidase 3) (OsCIN3) Length = 586 Score = 30.0 bits (66), Expect = 1.9 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 7/29 (24%) Frame = +1 Query: 40 TGMWECIDLYPV---GGA----RGIDMTE 105 TGMWEC D +PV GG+ RG+D E Sbjct: 234 TGMWECPDFFPVAVAGGSRHYRRGVDTAE 262
>CAD17_HUMAN (Q12864) Cadherin-17 precursor (Liver-intestine-cadherin)| (LI-cadherin) (Intestinal peptide-associated transporter HPT-1) Length = 832 Score = 28.1 bits (61), Expect = 7.2 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -2 Query: 106 PLSYRCPLH-RQPGINRCTPTCPSPV 32 PLSY +H + IN PTCPSPV Sbjct: 319 PLSYPLEIHVKVKDINDNPPTCPSPV 344
>CP19C_ARATH (Q38867) Peptidyl-prolyl cis-trans isomerase CYP19-3 (EC 5.2.1.8)| (PPIase CYP19-3) (Rotamase cyclophilin-2) (Cyclophilin of 19 kDa 3) (Cyclophilin-4) Length = 176 Score = 27.7 bits (60), Expect = 9.4 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 12/38 (31%) Frame = +3 Query: 30 CTGDGHVG------------VHRFIPGWRCKGHRYDRG 107 CTG+ +G HR IPG+ C+G + RG Sbjct: 40 CTGENGIGKAGKALHYKGSAFHRIIPGFMCQGGDFTRG 77 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,219,647 Number of Sequences: 219361 Number of extensions: 261538 Number of successful extensions: 1031 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1023 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1031 length of database: 80,573,946 effective HSP length: 11 effective length of database: 78,160,975 effective search space used: 1875863400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)