| Clone Name | baet81g05 |
|---|---|
| Clone Library Name | barley_pub |
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 32.3 bits (72), Expect = 0.37 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +1 Query: 22 PARRHCLPPPAAFRSRQPAPTYGTPLS 102 P RR LPPP + R P PTYG P S Sbjct: 506 PPRRIHLPPPPHRQPRPPTPTYGQPPS 532 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 22 PARRHCLPPPAAFRSRQPAPTYGTPLS 102 P R+ PPP ++ R P PTYG P S Sbjct: 540 PPRQIHSPPPPHWQPRTPTPTYGQPPS 566 Score = 28.5 bits (62), Expect = 5.3 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 22 PARRHCLPPPAAFRSRQPAPTYGTPLS 102 P R+ PPP + R P PTYG P S Sbjct: 574 PPRQIHSPPPPHRQPRPPTPTYGQPPS 600 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 43 PPPAAFRSRQPAPTYGTP 96 PPPA +S QP+PTY P Sbjct: 268 PPPAYAQSPQPSPTYSPP 285
>CT151_HUMAN (Q8NC74) Protein C20orf151| Length = 664 Score = 29.6 bits (65), Expect = 2.4 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 43 PPPAAFRSRQPAPTYGTPLSVGS-CRLSRPAA 135 PPP RS P+P Y LS+ S R SRP+A Sbjct: 243 PPPLPARSSPPSPAYERGLSLDSFLRASRPSA 274
>LCE3B_HUMAN (Q5TA77) Late cornified envelope protein 3B (Late envelope protein| 14) Length = 95 Score = 28.5 bits (62), Expect = 5.3 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 4 APSVLSPARRHCLPPPAAFRSRQPAPTYGTPLSVGSCRLSRPAACRS 144 +P + CLPP ++ + +P G P S G C LS CRS Sbjct: 18 SPKCPPKSSAQCLPPASSCCAPRPG-CCGGPSSEGGCCLSHHRCCRS 63
>SMUF1_DROME (Q9V853) E3 ubiquitin-protein ligase Smurf1 (EC 6.3.2.-) (Smad| ubiquitination regulatory factor 1 homolog) (DSmurf) (Lethal with a checkpoint kinase protein) Length = 1061 Score = 28.1 bits (61), Expect = 7.0 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 1 IAPSVLSPARRHCLPPPAAFRSRQPAPTYGTPLSVGSCRLSRPAA 135 ++ S+L RR +PP +A + PAP TP + + P A Sbjct: 594 LSGSILQMIRRGTVPPTSAANAGTPAPPSATPATPSAAAAVPPQA 638
>TCGAP_HUMAN (O14559) TC10/CDC42 GTPase-activating protein (Sorting nexin 26)| Length = 1287 Score = 28.1 bits (61), Expect = 7.0 Identities = 15/44 (34%), Positives = 19/44 (43%), Gaps = 13/44 (29%) Frame = +1 Query: 7 PSVLSPARRHCLPP-------------PAAFRSRQPAPTYGTPL 99 P SPA R CLPP P +F+ PAP + + L Sbjct: 1030 PGFFSPAPRECLPPFLGVPKPGLYPLGPPSFQPSSPAPVWRSSL 1073
>SMRD3_MOUSE (Q6P9Z1) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily D member 3 (60 kDa BRG-1/Brm-associated factor subunit C) (BRG1-associated factor 60C) (mBAF60c) Length = 483 Score = 28.1 bits (61), Expect = 7.0 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 IAPSVLSPARRHCLPPPAAFRSR---QPAPT 84 +AP+ + PAR+ PPP +++ QP PT Sbjct: 60 LAPAGMEPARKRAAPPPGQSQAQGQGQPVPT 90
>SMRD3_HUMAN (Q6STE5) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily D member 3 (60 kDa BRG-1/Brm-associated factor subunit C) (BRG1-associated factor 60C) Length = 483 Score = 28.1 bits (61), Expect = 7.0 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +1 Query: 1 IAPSVLSPARRHCLPPPAAFRSR---QPAPT 84 +AP+ + PAR+ PPP +++ QP PT Sbjct: 60 LAPAGMEPARKRAAPPPGQSQAQSQGQPVPT 90
>TOR_CAEEL (Q95Q95) Target of rapamycin homolog (EC 2.7.11.1) (CeTOR) (Lethal| protein 363) Length = 2697 Score = 27.7 bits (60), Expect = 9.1 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +1 Query: 16 LSPARRHCLPPPAAFRSRQPAPTYG--TPLSV 105 + P R PPP A +S QPAP + PLSV Sbjct: 1961 IPPVTRATSPPPPAQKSPQPAPFHSITEPLSV 1992 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,402,408 Number of Sequences: 219361 Number of extensions: 258969 Number of successful extensions: 1265 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1262 length of database: 80,573,946 effective HSP length: 24 effective length of database: 75,309,282 effective search space used: 1807422768 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)