| Clone Name | baet81f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RPOA_ANAMM (Q5PA81) DNA-directed RNA polymerase alpha chain (EC ... | 30 | 2.3 | 2 | ALGE_PSEAE (P18895) Alginate production protein algE precursor | 28 | 6.8 |
|---|
>RPOA_ANAMM (Q5PA81) DNA-directed RNA polymerase alpha chain (EC 2.7.7.6) (RNAP| alpha subunit) (Transcriptase alpha chain) (RNA polymerase alpha subunit) Length = 366 Score = 29.6 bits (65), Expect = 2.3 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -3 Query: 158 LLPFLGTERVEGRSWRAMDDGELGLSLASTALQEFNELEL 39 L F+G+E VEG S + +D E L L++ +ELEL Sbjct: 253 LQSFIGSEEVEGESRKKVDKEEGALPYDHNLLRKVDELEL 292
>ALGE_PSEAE (P18895) Alginate production protein algE precursor| Length = 490 Score = 28.1 bits (61), Expect = 6.8 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -3 Query: 116 WRAMDDGELGLSLASTALQEFNE---LELECTVLLYFTSGL 3 WR DD ++G S + ALQ + EL+ V YF GL Sbjct: 402 WRVDDDSDIGTSGINAALQPGEKDIGQELDLVVTKYFKQGL 442 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.305 0.127 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,961,664 Number of Sequences: 219361 Number of extensions: 205253 Number of successful extensions: 312 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 312 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits)