| Clone Name | baet81d11 |
|---|---|
| Clone Library Name | barley_pub |
>TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) (OsTIP2.2) Length = 248 Score = 81.3 bits (199), Expect = 7e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +3 Query: 66 MPGSIAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAYT 197 M G+IAFGRFDDSFS ASLKAYVAEFISTL+FVFAGVGSAIAYT Sbjct: 1 MSGNIAFGRFDDSFSAASLKAYVAEFISTLVFVFAGVGSAIAYT 44
>TIP21_ARATH (Q41951) Aquaporin TIP2.1 (Tonoplast intrinsic protein 2.1)| (Delta-tonoplast intrinsic protein) (Delta-TIP) Length = 250 Score = 70.1 bits (170), Expect = 2e-12 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 78 IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAY 194 +AFG FDDSFS+ASL+AY+AEFISTL+FVFAGVGSAIAY Sbjct: 4 VAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAY 42
>TIP_ANTMA (P33560) Probable aquaporin TIP-type (Tonoplast intrinsic protein| DiP) (Dark intrinsic protein) Length = 250 Score = 67.0 bits (162), Expect = 1e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 78 IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAY 194 IAFG DSFSVAS+KAYVAEFI+TL+FVFAGVGSAIAY Sbjct: 4 IAFGSIGDSFSVASIKAYVAEFIATLLFVFAGVGSAIAY 42
>TIP2_TOBAC (P24422) Probable aquaporin TIP-type RB7-18C (Tonoplast intrinsic| protein, root-specific RB7-18C) (TobRB7) (RT-TIP) Length = 250 Score = 66.2 bits (160), Expect = 2e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 78 IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAY 194 IAFG DSFSV SLKAYVAEFI+TL+FVFAGVGSAIAY Sbjct: 4 IAFGSIGDSFSVGSLKAYVAEFIATLLFVFAGVGSAIAY 42
>TIP1_TOBAC (P21653) Probable aquaporin TIP-type RB7-5A (Tonoplast intrinsic| protein, root-specific RB7-5A) (TobRB7) (RT-TIP) Length = 250 Score = 66.2 bits (160), Expect = 2e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 78 IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAY 194 IAFG DSFSV SLKAYVAEFI+TL+FVFAGVGSAIAY Sbjct: 4 IAFGSIGDSFSVGSLKAYVAEFIATLLFVFAGVGSAIAY 42
>TIP21_ORYSA (Q7XA61) Probable aquaporin TIP2.1 (Tonoplast intrinsic protein| 2.1) (OsTIP2.1) Length = 248 Score = 62.8 bits (151), Expect = 2e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 78 IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAY 194 +AFG DSFS S+KAYVAEFI+TL+FVFAGVGSAIAY Sbjct: 4 LAFGSLGDSFSATSVKAYVAEFIATLLFVFAGVGSAIAY 42
>TIP22_ARATH (Q41975) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) Length = 250 Score = 58.5 bits (140), Expect = 5e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +3 Query: 78 IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAY 194 I G DSFSVASLKAY++EFI+TL+FVFAGVGSA+A+ Sbjct: 4 IEIGSVGDSFSVASLKAYLSEFIATLLFVFAGVGSALAF 42
>TIP23_ARATH (Q9FGL2) Probable aquaporin TIP2.3 (Tonoplast intrinsic protein| 2.3) Length = 250 Score = 57.4 bits (137), Expect = 1e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 78 IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAY 194 I G DSFSV+SLKAY++EFI+TL+FVFAGVGSA+A+ Sbjct: 4 IEVGSVGDSFSVSSLKAYLSEFIATLLFVFAGVGSAVAF 42
>TIP11_ORYSA (P50156) Probable aquaporin TIP1.1 (Tonoplast intrinsic protein| 1.1) (OsTIP1.1) (rTIP1) Length = 250 Score = 44.7 bits (104), Expect = 7e-05 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = +3 Query: 75 SIAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAYT 197 +IA G + + +LKA +AEFISTLIFVFAG GS +A++ Sbjct: 5 NIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFS 45
>TIP11_ARATH (P25818) Aquaporin TIP1.1 (Tonoplast intrinsic protein 1.1)| (Gamma-tonoplast intrinsic protein) (Gamma-TIP) (Aquaporin-TIP) (Tonoplast intrinsic protein, root-specific RB7) Length = 251 Score = 43.9 bits (102), Expect = 1e-04 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +3 Query: 75 SIAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAY 194 +IA GR D++ +LKA +AEFISTLIFV AG GS +A+ Sbjct: 5 NIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAF 44
>TIP1_MEDSA (P42067) Probable aquaporin TIP-type (Membrane channel protein 1)| (MsMCP1) Length = 249 Score = 42.4 bits (98), Expect = 3e-04 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = +3 Query: 75 SIAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAY 194 +IA G ++ +LKA +AEFIST IFVFAG GS IAY Sbjct: 5 NIAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAY 44
>TIP1_MEDTR (Q9FY14) Probable aquaporin TIP-type (MtAQP1)| Length = 250 Score = 42.4 bits (98), Expect = 3e-04 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = +3 Query: 75 SIAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAY 194 +IA G ++ +LKA +AEFIST IFVFAG GS IAY Sbjct: 5 NIAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAY 44
>TIPA_PHAVU (P23958) Probable aquaporin TIP-type alpha (Tonoplast intrinsic| protein alpha) (Alpha TIP) Length = 256 Score = 41.6 bits (96), Expect = 6e-04 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = +3 Query: 81 AFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIA 191 +FGR D++ S++A +AEF ST IFVFAG GS +A Sbjct: 7 SFGRTDEATHPDSMRASLAEFASTFIFVFAGEGSGLA 43
>TIP32_ARATH (O22588) Probable aquaporin TIP3.2 (Tonoplast intrinsic protein| 3.2) (Beta-tonoplast intrinsic protein) (Beta-TIP) Length = 267 Score = 41.6 bits (96), Expect = 6e-04 Identities = 19/36 (52%), Positives = 27/36 (75%) Frame = +3 Query: 84 FGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIA 191 FGR D++ S++A +AEF+ST +FVFAG GS +A Sbjct: 11 FGRADEATHPDSIRATLAEFLSTFVFVFAGEGSILA 46
>TIP12_ARATH (Q41963) Aquaporin TIP1.2 (Tonoplast intrinsic protein 1.2)| (Gamma-tonoplast intrinsic protein 2) (Gamma-TIP2) (Salt stress-induced tonoplast intrinsic protein) Length = 253 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +3 Query: 117 SLKAYVAEFISTLIFVFAGVGSAIAY 194 +L+A +AEFISTLIFVFAG GS IA+ Sbjct: 20 ALRAALAEFISTLIFVFAGSGSGIAF 45
>AQP5_HUMAN (P55064) Aquaporin-5 (AQP-5)| Length = 265 Score = 39.3 bits (90), Expect = 0.003 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAIAY 194 SVA LKA AEF++TLIFVF G+GSA+ + Sbjct: 7 SVAFLKAVFAEFLATLIFVFFGLGSALKW 35
>TIP41_ARATH (O82316) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (Epsilon-tonoplast intrinsic protein) (Epsilon-TIP) Length = 249 Score = 38.9 bits (89), Expect = 0.004 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +3 Query: 78 IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIA 191 I G ++ +KA + EFI+T +FVFAGVGSA+A Sbjct: 4 IELGHHSEAAKPDCIKALIVEFITTFLFVFAGVGSAMA 41
>TIP31_ARATH (P26587) Aquaporin TIP3.1 (Tonoplast intrinsic protein 3.1)| (Alpha-tonoplast intrinsic protein) (Alpha-TIP) Length = 268 Score = 38.1 bits (87), Expect = 0.006 Identities = 17/36 (47%), Positives = 26/36 (72%) Frame = +3 Query: 84 FGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIA 191 FGR D++ S++A +AEF+ST +FVFA GS ++ Sbjct: 11 FGRADEATHPDSIRATLAEFLSTFVFVFAAEGSILS 46
>AQP5_SHEEP (Q866S3) Aquaporin-5 (AQP-5)| Length = 265 Score = 37.7 bits (86), Expect = 0.008 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAIAY 194 S A LKA AEF++TLIFVF G+GSA+ + Sbjct: 7 SAAFLKAVFAEFLATLIFVFFGLGSALKW 35
>AQP5_MOUSE (Q9WTY4) Aquaporin-5 (AQP-5)| Length = 265 Score = 37.7 bits (86), Expect = 0.008 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAIAY 194 SVA KA AEF++TLIFVF G+GSA+ + Sbjct: 7 SVAFFKAVFAEFLATLIFVFFGLGSALKW 35
>AQP2_DASNO (P79164) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 37.4 bits (85), Expect = 0.011 Identities = 17/29 (58%), Positives = 25/29 (86%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAIAY 194 SVA +A +AEF++TLIFVF G+GSA+++ Sbjct: 1 SVAFSRAVLAEFLATLIFVFFGLGSALSW 29
>TIP12_ORYSA (Q94CS9) Probable aquaporin TIP1.2 (Tonoplast intrinsic protein| 1.2) (OsTIP1.2) Length = 252 Score = 37.4 bits (85), Expect = 0.011 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = +3 Query: 66 MPGS-IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAYT 197 MP S IA G + + KA VAEFIS LIFVFAG GS +A++ Sbjct: 1 MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFS 45
>TIP51_ORYSA (Q7XU31) Probable aquaporin TIP5.1 (Tonoplast intrinsic protein| 5.1) (OsTIP5.1) Length = 269 Score = 37.0 bits (84), Expect = 0.014 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +3 Query: 105 FSVASLKAYVAEFISTLIFVFAGVGSAIA 191 FS +L+AY AEF ST +FVF VGS I+ Sbjct: 12 FSPPALRAYFAEFFSTFLFVFIAVGSTIS 40
>AQP5_RAT (P47864) Aquaporin-5 (AQP-5)| Length = 265 Score = 36.6 bits (83), Expect = 0.019 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAIAY 194 S+A KA AEF++TLIFVF G+GSA+ + Sbjct: 7 SLAFFKAVFAEFLATLIFVFFGLGSALKW 35
>TIP43_ORYSA (Q9LWR2) Probable aquaporin TIP4.3 (Tonoplast intrinsic protein| 4.3) (OsTIP4.3) Length = 251 Score = 36.2 bits (82), Expect = 0.024 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +3 Query: 78 IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIA 191 +A G ++ L+A VAE + T +FVF+GVGSA+A Sbjct: 4 LALGHHREATDPGCLRAVVAELLLTFLFVFSGVGSAMA 41
>TIP51_ARATH (Q9STX9) Putative aquaporin TIP5.1 (Tonoplast intrinsic protein| 5.1) Length = 256 Score = 35.8 bits (81), Expect = 0.032 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +3 Query: 90 RFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIA 191 +F S+ +L+ YV+EFIST FV A VGS ++ Sbjct: 12 KFQGVLSMNALRCYVSEFISTFFFVLAAVGSVMS 45
>AQP2_RAT (P34080) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 35.4 bits (80), Expect = 0.041 Identities = 15/29 (51%), Positives = 24/29 (82%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAIAY 194 S+A +A +AEF++TL+FVF G+GSA+ + Sbjct: 6 SIAFSRAVLAEFLATLLFVFFGLGSALQW 34
>AQP2_MOUSE (P56402) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 35.4 bits (80), Expect = 0.041 Identities = 15/29 (51%), Positives = 24/29 (82%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAIAY 194 S+A +A +AEF++TL+FVF G+GSA+ + Sbjct: 6 SIAFSRAVLAEFLATLLFVFFGLGSALQW 34
>AQP2_TALEU (O77740) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 35.0 bits (79), Expect = 0.054 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A AEF++TLIFVF G+GSA+ Sbjct: 1 SIAFSRAVFAEFLATLIFVFFGLGSAL 27
>AQP2_HORSE (P79165) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 35.0 bits (79), Expect = 0.054 Identities = 15/27 (55%), Positives = 23/27 (85%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A +AEF++TL+FVF G+GSA+ Sbjct: 1 SIAFSRAVLAEFLATLLFVFFGLGSAL 27
>AQP2_BOVIN (P79099) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 35.0 bits (79), Expect = 0.054 Identities = 15/27 (55%), Positives = 23/27 (85%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A +AEF++TL+FVF G+GSA+ Sbjct: 1 SIAFSRAVLAEFLATLLFVFFGLGSAL 27
>TIP13_ARATH (O82598) Putative aquaporin TIP1.3 (Tonoplast intrinsic protein| 1.3) (Gamma-tonoplast intrinsic protein 3) (Gamma-TIP3) Length = 252 Score = 35.0 bits (79), Expect = 0.054 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = +3 Query: 78 IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAY 194 IA G ++ +++A AEF S +IFVFAG GS +AY Sbjct: 6 IAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAY 44
>AQP2_SHEEP (O62735) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 35.0 bits (79), Expect = 0.054 Identities = 15/27 (55%), Positives = 23/27 (85%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A +AEF++TL+FVF G+GSA+ Sbjct: 6 SIAFSRAVLAEFLATLLFVFFGLGSAL 32
>AQP2_CANFA (P79144) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 34.7 bits (78), Expect = 0.071 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 SVA +A AEF++TL+FVF G+GSA+ Sbjct: 1 SVAFSRAVFAEFLATLLFVFFGLGSAL 27
>AQP2_RABIT (P79213) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 34.3 bits (77), Expect = 0.092 Identities = 15/27 (55%), Positives = 22/27 (81%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A AEF++TL+FVF G+GSA+ Sbjct: 1 SIAFSRAVFAEFLATLLFVFFGLGSAL 27
>AQP2_ORYAF (P79200) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 34.3 bits (77), Expect = 0.092 Identities = 15/27 (55%), Positives = 22/27 (81%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A KA +EF++TL+FVF G+GSA+ Sbjct: 1 SIAFSKAVFSEFLATLLFVFFGLGSAL 27
>AQP2_HUMAN (P41181) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 34.3 bits (77), Expect = 0.092 Identities = 15/27 (55%), Positives = 22/27 (81%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A AEF++TL+FVF G+GSA+ Sbjct: 6 SIAFSRAVFAEFLATLLFVFFGLGSAL 32
>AQP2_PROHA (P79229) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 33.9 bits (76), Expect = 0.12 Identities = 14/27 (51%), Positives = 23/27 (85%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A ++EF++TL+FVF G+GSA+ Sbjct: 1 SIAFSRAVLSEFLATLLFVFFGLGSAL 27
>TIP31_ORYSA (Q9FWV6) Probable aquaporin TIP3.1 (Tonoplast intrinsic protein| 3.1) (OsTIP3.1) Length = 264 Score = 33.9 bits (76), Expect = 0.12 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +3 Query: 60 ATMPGS-IAFGRFDDSFSVASLKAYVAEFISTLIFVFAGVGSAIA 191 A PG GR +D+ +++A ++EF++T IFVFA GS ++ Sbjct: 5 AARPGRRFTVGRSEDATHPDTIRAAISEFLATAIFVFAAEGSILS 49
>AQP2_ELEMA (P79168) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 33.1 bits (74), Expect = 0.21 Identities = 14/27 (51%), Positives = 22/27 (81%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A +EF++TL+FVF G+GSA+ Sbjct: 1 SIAFSRAVFSEFLATLLFVFFGLGSAL 27
>AQP2_DUGDU (O77714) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 33.1 bits (74), Expect = 0.21 Identities = 14/27 (51%), Positives = 22/27 (81%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A +EF++TL+FVF G+GSA+ Sbjct: 1 SIAFSRAVFSEFLATLLFVFFGLGSAL 27
>AQP2_AMBHO (O77697) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 33.1 bits (74), Expect = 0.21 Identities = 14/27 (51%), Positives = 22/27 (81%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A +EF++TL+FVF G+GSA+ Sbjct: 1 SIAFSRAVFSEFLATLLFVFFGLGSAL 27
>AQP2_MACPR (P79803) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 111 Score = 33.1 bits (74), Expect = 0.21 Identities = 14/27 (51%), Positives = 22/27 (81%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A +EF++TL+FVF G+GSA+ Sbjct: 1 SIAFSRAVFSEFLATLLFVFFGLGSAL 27
>AQP2_ERIEU (O77722) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 32.7 bits (73), Expect = 0.27 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAI 188 S+A +A EF++TL+FVF G+GSA+ Sbjct: 1 SIAFSRAVFTEFLATLLFVFFGLGSAL 27
>AQP4_MOUSE (P55088) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 32.3 bits (72), Expect = 0.35 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +3 Query: 93 FDDSFSVASLKAYVAEFISTLIFVFAGVGSAI 188 F ++ A KA AEF++TLIFV GVGS I Sbjct: 26 FKGVWTQAFWKAVSAEFLATLIFVLLGVGSTI 57
>TSAK_RICTS (P37915) 56 kDa type-specific antigen precursor (TSA) (56 kDa scrub| typhus antigen) (STA56) (TSK56) Length = 532 Score = 31.6 bits (70), Expect = 0.60 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 93 FDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAYT 197 FD S V +K Y I+ + ++AGVG+ +AYT Sbjct: 433 FDLSMIVGQVKLYADVMITESVSIYAGVGAGLAYT 467
>AQP1_HUMAN (P29972) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Urine water channel) Length = 268 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A VAEF++T +FVF +GSA+ + Sbjct: 11 RAVVAEFLATTLFVFISIGSALGF 34
>AQP1_CANFA (Q9N2J4) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 270 Score = 30.4 bits (67), Expect = 1.3 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A VAEF++ ++FVF +GSA+ + Sbjct: 11 RAVVAEFLAMILFVFISIGSALGF 34
>AQP1_SHEEP (P56401) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 271 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A VAEF++ ++F+F +GSA+ + Sbjct: 11 RAVVAEFLAMILFIFISIGSALGF 34
>AQP1_BOVIN (P47865) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Water channel protein CHIP29) Length = 270 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A VAEF++ ++F+F +GSA+ + Sbjct: 11 RAVVAEFLAMILFIFISIGSALGF 34
>TSAT_RICTS (P37918) 56 kDa type-specific antigen precursor (TSA) (56 kDa scrub| typhus antigen) (STA56) (TST56) Length = 529 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 93 FDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAYT 197 FD S V +K Y F + ++AG+G+ +AYT Sbjct: 430 FDLSMIVGQVKLYADLFTTESFSIYAGLGAGLAYT 464
>AQP1_RAT (P29975) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 268 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A VAEF++ +FVF +GSA+ + Sbjct: 11 RAVVAEFLAMTLFVFISIGSALGF 34
>AQP1_PONPY (Q5R819) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 268 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A VAEF++ +FVF +GSA+ + Sbjct: 11 RAVVAEFLAMTLFVFISIGSALGF 34
>AQP1_MOUSE (Q02013) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Early response protein DER2) Length = 268 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A VAEF++ +FVF +GSA+ + Sbjct: 11 RAVVAEFLAMTLFVFISIGSALGF 34
>AQPA_RANES (P50501) Aquaporin FA-CHIP| Length = 272 Score = 28.9 bits (63), Expect = 3.9 Identities = 9/24 (37%), Positives = 19/24 (79%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A +AEF++ ++FVF +G+A+ + Sbjct: 12 RAVIAEFLAMILFVFISIGAALGF 35
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 28.9 bits (63), Expect = 3.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A +AEF++TLIF++ + + I Y Sbjct: 44 RALIAEFMATLIFLYVSIATVIGY 67
>AQPZ_SYNY3 (P73809) Aquaporin Z| Length = 247 Score = 28.9 bits (63), Expect = 3.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 120 LKAYVAEFISTLIFVFAGVGSAI 188 +K Y+AEFI T V G GSA+ Sbjct: 1 MKKYIAEFIGTFWLVLGGCGSAV 23
>AQPM_METTM (Q9C4Z5) Aquaporin aqpM| Length = 246 Score = 28.9 bits (63), Expect = 3.9 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +3 Query: 111 VASLKAYVAEFISTLIFVFAGVGSA 185 V+ K +AEFI T I VF G GSA Sbjct: 2 VSLTKRCIAEFIGTFILVFFGAGSA 26
>AQP1_PIG (Q6PQZ1) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 270 Score = 28.9 bits (63), Expect = 3.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A VAEF++ +F+F +GSA+ + Sbjct: 11 RAVVAEFLAMTLFIFISIGSALGF 34
>TSAG_RICTS (P22940) 56 kDa type-specific antigen precursor (TSA) (56 kDa scrub| typhus antigen) (STA56) (TSG56) Length = 524 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 93 FDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAYT 197 FD S V +K Y F + ++AGVG+ +A+T Sbjct: 425 FDLSMIVGQVKLYADLFTTESFSIYAGVGAGLAHT 459
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 28.5 bits (62), Expect = 5.1 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A +AEF++TL+F++ V + I Y Sbjct: 39 RALIAEFVATLLFLYVTVATVIGY 62
>MIP_RAT (P09011) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) (Fragment) Length = 261 Score = 28.5 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAIAY 194 S + +A AEF +TL +VF G+GS++ + Sbjct: 4 SASFWRAIFAEFFATLFYVFFGLGSSLRW 32
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 28.5 bits (62), Expect = 5.1 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A +AEFI+TL+F++ V + I Y Sbjct: 42 RAVIAEFIATLLFLYITVATVIGY 65
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 28.5 bits (62), Expect = 5.1 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A +AEFI+TL+F++ V + I Y Sbjct: 38 RALIAEFIATLLFLYITVATVIGY 61
>AQP6_RAT (Q9WTY0) Aquaporin-6 (AQP-6)| Length = 276 Score = 28.5 bits (62), Expect = 5.1 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 KA AEF++T ++VF GVGS + + Sbjct: 22 KALFAEFLATGLYVFFGVGSVLPW 45
>AQP4_RAT (P47863) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 28.5 bits (62), Expect = 5.1 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +3 Query: 93 FDDSFSVASLKAYVAEFISTLIFVFAGVGSAI 188 F ++ A KA AEF++ LIFV VGS I Sbjct: 26 FKGVWTQAFWKAVTAEFLAMLIFVLLSVGSTI 57
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 28.5 bits (62), Expect = 5.1 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A +AEF++TL+F++ V + I Y Sbjct: 36 RAVIAEFVATLLFLYVTVATVIGY 59
>TSAR_RICTS (P37916) 56 kDa type-specific antigen precursor (TSA) (56 kDa scrub| typhus antigen) (STA56) (TSR56) Length = 532 Score = 28.5 bits (62), Expect = 5.1 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +3 Query: 72 GSIAFGRFDDSFSVASLKAYVAEFISTLIF-VFAGVGSAIAYT 197 G + FD S V +K Y A+ ++T F ++ GVG+ +AYT Sbjct: 426 GKVKETEFDLSMVVGQVKLY-ADLVTTESFSIYGGVGAGLAYT 467
>MIP_HUMAN (P30301) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) Length = 263 Score = 28.5 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +3 Query: 108 SVASLKAYVAEFISTLIFVFAGVGSAIAY 194 S + +A AEF +TL +VF G+GS++ + Sbjct: 6 SASFWRAIFAEFFATLFYVFFGLGSSLRW 34
>AQP6_MOUSE (Q8C4A0) Aquaporin-6 (AQP-6)| Length = 293 Score = 28.5 bits (62), Expect = 5.1 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 KA AEF++T ++VF GVGS + + Sbjct: 22 KALFAEFLATGLYVFFGVGSVLPW 45
>TSAS_RICTS (P37917) 56 kDa type-specific antigen precursor (TSA) (56 kDa scrub| typhus antigen) (STA56) (TSS56) Length = 521 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 93 FDDSFSVASLKAYVAEFISTLIFVFAGVGSAIAYT 197 FD +V +K Y F V+AG+G+ +AYT Sbjct: 422 FDLHMAVGQVKLYADLFTIDSFSVYAGIGAGLAYT 456
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 28.5 bits (62), Expect = 5.1 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A +AEFI+TL+F++ V + I Y Sbjct: 41 RAVIAEFIATLLFLYITVATVIGY 64
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 28.1 bits (61), Expect = 6.6 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A +AEF++TL+F++ V + I Y Sbjct: 42 RAVIAEFVATLLFLYITVATVIGY 65
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 123 KAYVAEFISTLIFVFAGVGSAIAY 194 +A +AEFI+TL+F++ V + I Y Sbjct: 40 RAAIAEFIATLLFLYITVATVIGY 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,497,062 Number of Sequences: 219361 Number of extensions: 262438 Number of successful extensions: 1184 Number of sequences better than 10.0: 74 Number of HSP's better than 10.0 without gapping: 1147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1184 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)