| Clone Name | baet81b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RNS1_ARATH (P42813) Ribonuclease 1 precursor (EC 3.1.27.1) | 40 | 0.002 | 2 | RNS3_ARATH (P42815) Ribonuclease 3 precursor (EC 3.1.27.1) | 35 | 0.039 | 3 | RNLE_LYCES (P80022) Extracellular ribonuclease LE precursor (EC ... | 35 | 0.051 | 4 | RNS4_ANTHI (Q38717) Ribonuclease S-4 precursor (EC 3.1.27.1) (St... | 30 | 1.2 | 5 | RNS2_ARATH (P42814) Ribonuclease 2 precursor (EC 3.1.27.1) | 29 | 3.6 | 6 | Y4RN_RHISN (P55647) Hypothetical transport protein y4rN | 28 | 6.2 |
|---|
>RNS1_ARATH (P42813) Ribonuclease 1 precursor (EC 3.1.27.1)| Length = 230 Score = 39.7 bits (91), Expect = 0.002 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 4/63 (6%) Frame = +3 Query: 30 ALLCLLGMLI----ASSAIAVSDSGIYYQIGLMWPGAYCVQTTGGCCMPKSPIVPAADFY 197 A LCL+ +L+ SA + S+ ++ WPG+YC T CC P S PAADF Sbjct: 6 ASLCLISLLVILPSVFSASSSSEDFDFFYFVQQWPGSYC-DTQKKCCYPNSG-KPAADFG 63 Query: 198 VSG 206 + G Sbjct: 64 IHG 66
>RNS3_ARATH (P42815) Ribonuclease 3 precursor (EC 3.1.27.1)| Length = 222 Score = 35.4 bits (80), Expect = 0.039 Identities = 24/64 (37%), Positives = 33/64 (51%) Frame = +3 Query: 15 MAFRRALLCLLGMLIASSAIAVSDSGIYYQIGLMWPGAYCVQTTGGCCMPKSPIVPAADF 194 M F +L L + + S A D +Y + L WPGAYC + CC P++ PAADF Sbjct: 1 MKFFIFILALQQLYVQSFA---QDFDFFYFV-LQWPGAYC-DSRHSCCYPQTG-KPAADF 54 Query: 195 YVSG 206 + G Sbjct: 55 GIHG 58
>RNLE_LYCES (P80022) Extracellular ribonuclease LE precursor (EC 3.1.27.1)| (RNase LE) Length = 230 Score = 35.0 bits (79), Expect = 0.051 Identities = 23/63 (36%), Positives = 30/63 (47%) Frame = +3 Query: 18 AFRRALLCLLGMLIASSAIAVSDSGIYYQIGLMWPGAYCVQTTGGCCMPKSPIVPAADFY 197 AF L+ L+ S A D +Y + WPG+YC T CC P + PAADF Sbjct: 6 AFSLFLILLIITQCLSVLNAAKDFDFFYFVQ-QWPGSYC-DTKQSCCYPTTG-KPAADFG 62 Query: 198 VSG 206 + G Sbjct: 63 IHG 65
>RNS4_ANTHI (Q38717) Ribonuclease S-4 precursor (EC 3.1.27.1) (Stylar| glycoprotein 4) (S4-RNase) Length = 233 Score = 30.4 bits (67), Expect = 1.2 Identities = 20/75 (26%), Positives = 41/75 (54%) Frame = +3 Query: 33 LLCLLGMLIASSAIAVSDSGIYYQIGLMWPGAYCVQTTGGCCMPKSPIVPAADFYVSGFT 212 ++C++ + S+ IA D Y ++ L WP ++C+ + C ++P+ ++F + G Sbjct: 17 VVCVVPLNCCSTIIAKCD---YLKLVLQWPKSFCLINSRKC--QRNPL--PSNFTIHGLW 69 Query: 213 VLNATTDAPETSCSS 257 N T AP+ SC++ Sbjct: 70 PDNYTRQAPQ-SCTT 83
>RNS2_ARATH (P42814) Ribonuclease 2 precursor (EC 3.1.27.1)| Length = 259 Score = 28.9 bits (63), Expect = 3.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 10/51 (19%) Frame = +3 Query: 36 LCLLGMLIASSAIAVSDSGI----------YYQIGLMWPGAYCVQTTGGCC 158 LCLL +L+A A A + I Y+ + L WPG YC + T CC Sbjct: 5 LCLL-LLVACIAGAFAGDVIELNRSQREFDYFALSLQWPGTYC-RGTRHCC 53
>Y4RN_RHISN (P55647) Hypothetical transport protein y4rN| Length = 405 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -1 Query: 262 GVLLQLVSGASVVAFKTVKPET*KSAAGTMGLLGMQHPPVVCT 134 GVLL V V + +A G LG PPVVCT Sbjct: 70 GVLLDCVGPTIAVRIDMIASTAFITAISLAGWLGWSSPPVVCT 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,764,771 Number of Sequences: 219361 Number of extensions: 570263 Number of successful extensions: 1554 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1554 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)