| Clone Name | baet81a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YAI7_SCHPO (Q09894) Hypothetical protein C24B11.07c in chromosome I | 31 | 1.00 | 2 | PCDH8_HUMAN (O95206) Protocadherin-8 precursor (Arcadlin) | 30 | 2.2 | 3 | BAI2_HUMAN (O60241) Brain-specific angiogenesis inhibitor 2 prec... | 28 | 6.5 | 4 | KAPR_CANAL (Q9HEW1) cAMP-dependent protein kinase regulatory sub... | 28 | 8.4 |
|---|
>YAI7_SCHPO (Q09894) Hypothetical protein C24B11.07c in chromosome I| Length = 561 Score = 30.8 bits (68), Expect = 1.00 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +1 Query: 1 ISPH-KQHTHKLVTTRPARFS*LSHPGQSTAKMASLTVSQTTPAASNANKQREGAEIITG 177 +SP K+HTHK ++ +RF S P S+ + + +S+ + SN+ + R G +G Sbjct: 454 LSPEAKEHTHKNISPESSRFGTPSDPNSSSQSLGNEVLSRPN-SNSNSAESRNGETDDSG 512 Query: 178 AEACY 192 Y Sbjct: 513 ESETY 517
>PCDH8_HUMAN (O95206) Protocadherin-8 precursor (Arcadlin)| Length = 1070 Score = 29.6 bits (65), Expect = 2.2 Identities = 17/59 (28%), Positives = 23/59 (38%) Frame = +1 Query: 43 RPARFS*LSHPGQSTAKMASLTVSQTTPAASNANKQREGAEIITGAEACYAHSKELLKG 219 RP F L+ PG A S PA + A TG AC+ ++ L+G Sbjct: 815 RPNMFDVLTFPGTGKAPFGSPAADAPPPAVAAAEVPGSEGGSATGESACHFEGQQRLRG 873
>BAI2_HUMAN (O60241) Brain-specific angiogenesis inhibitor 2 precursor| Length = 1572 Score = 28.1 bits (61), Expect = 6.5 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 3 LTTQAAHTQASHNSTSTFQ-LAKPPRTINSE 92 L TQAAHT+ STF LA+PP+ + E Sbjct: 885 LETQAAHTRCQCQHLSTFAVLAQPPKDLTLE 915
>KAPR_CANAL (Q9HEW1) cAMP-dependent protein kinase regulatory subunit (PKA| regulatory subunit) (PKA-R) Length = 459 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 46 PARFS*LSHPGQSTAKMASLTVSQTTPAASNANKQ 150 P++ S S P Q +A +S T S P A NAN++ Sbjct: 144 PSKPSSSSQPNQQSASASSKTPSSKIPVAFNANRR 178 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,588,026 Number of Sequences: 219361 Number of extensions: 299176 Number of successful extensions: 861 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 861 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)