| Clone Name | baet81a06 |
|---|---|
| Clone Library Name | barley_pub |
>RNS1_ARATH (P42813) Ribonuclease 1 precursor (EC 3.1.27.1)| Length = 230 Score = 70.5 bits (171), Expect = 1e-12 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +1 Query: 82 EEFDFFYLVQQWPGSFCDTKKGCCFPDTGKPATDF 186 E+FDFFY VQQWPGS+CDT+K CC+P++GKPA DF Sbjct: 28 EDFDFFYFVQQWPGSYCDTQKKCCYPNSGKPAADF 62
>RNLE_LYCES (P80022) Extracellular ribonuclease LE precursor (EC 3.1.27.1)| (RNase LE) Length = 230 Score = 70.5 bits (171), Expect = 1e-12 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 82 EEFDFFYLVQQWPGSFCDTKKGCCFPDTGKPATDF 186 ++FDFFY VQQWPGS+CDTK+ CC+P TGKPA DF Sbjct: 27 KDFDFFYFVQQWPGSYCDTKQSCCYPTTGKPAADF 61
>RNLX_LYCES (P80196) Intracellular ribonuclease LX precursor (EC 3.1.27.1)| (RNase LX) Length = 237 Score = 65.1 bits (157), Expect = 5e-11 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +1 Query: 82 EEFDFFYLVQQWPGSFCDTKKGCCFPDTGKPATDF 186 ++FDFFY VQQWP S+CDT++ CC+P TGKP DF Sbjct: 26 QDFDFFYFVQQWPASYCDTRRSCCYPTTGKPDEDF 60
>RNS3_ARATH (P42815) Ribonuclease 3 precursor (EC 3.1.27.1)| Length = 222 Score = 63.9 bits (154), Expect = 1e-10 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = +1 Query: 82 EEFDFFYLVQQWPGSFCDTKKGCCFPDTGKPATDF 186 ++FDFFY V QWPG++CD++ CC+P TGKPA DF Sbjct: 20 QDFDFFYFVLQWPGAYCDSRHSCCYPQTGKPAADF 54
>RNS2_ARATH (P42814) Ribonuclease 2 precursor (EC 3.1.27.1)| Length = 259 Score = 35.0 bits (79), Expect = 0.055 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 85 EFDFFYLVQQWPGSFCDTKKGCC 153 EFD+F L QWPG++C + CC Sbjct: 31 EFDYFALSLQWPGTYCRGTRHCC 53
>RNS2_ANTHI (Q38716) Ribonuclease S-2 precursor (EC 3.1.27.1) (Stylar| glycoprotein 2) (S2-RNase) Length = 235 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +1 Query: 85 EFDFFYLVQQWPGSFCDTKKGCCFPDTGKPA 177 +FD+F LV QWP S+C K C P T P+ Sbjct: 32 QFDYFKLVLQWPNSYCSLKTTHC-PRTRLPS 61
>RNS3_PETHY (Q40875) Ribonuclease S-3 precursor (EC 3.1.27.1) (Stylar| glycoprotein 3) (S3-RNase) Length = 222 Score = 31.6 bits (70), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 88 FDFFYLVQQWPGSFCDTKKGC 150 FD+F LV WP SFC K C Sbjct: 24 FDYFQLVLTWPASFCYPKNKC 44
>RNMC_MOMCH (P23540) Ribonuclease MC (EC 3.1.27.1) (RNase MC)| Length = 191 Score = 30.8 bits (68), Expect = 1.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 88 FDFFYLVQQWPGSFCDTKKGCCFPDTG 168 FD F+ VQQWP + C +K P +G Sbjct: 1 FDSFWFVQQWPPAVCSFQKSGSCPGSG 27
>RNOY_CRAGI (Q7M456) Ribonuclease Oy (EC 3.1.27.-) (RNase Oy)| Length = 213 Score = 30.4 bits (67), Expect = 1.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 82 EEFDFFYLVQQWPGSFCDTKKGCCFPDT 165 +++++F QQWP + C K C PD+ Sbjct: 1 KDWNYFTFAQQWPIAVCAEHKSCFIPDS 28
>RNDI_DICDI (Q7M438) Ribonuclease DdI precursor (EC 3.1.27.1) (RNase DdI)| Length = 223 Score = 29.6 bits (65), Expect = 2.3 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 85 EFDFFYLVQQWPGSFCDTK 141 +FDF+ VQQW S+CD++ Sbjct: 31 DFDFYLFVQQWIYSYCDSQ 49
>CAPP_RALSO (Q8XWW2) Phosphoenolpyruvate carboxylase (EC 4.1.1.31) (PEPCase)| (PEPC) Length = 985 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 Query: 9 LTGQDEARRALGPAPAFS 62 LTG+D R A+GPAPA++ Sbjct: 399 LTGEDAGRHAVGPAPAYT 416 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,364,630 Number of Sequences: 219361 Number of extensions: 288192 Number of successful extensions: 1068 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1041 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1068 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)