| Clone Name | baet80d11 |
|---|---|
| Clone Library Name | barley_pub |
>ABP20_PRUPE (O04011) Auxin-binding protein ABP20 precursor| Length = 214 Score = 42.7 bits (99), Expect = 3e-04 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = +1 Query: 46 LLPVLISFLVLPFSAMALTQDFCVADLSCSDTPAXYPCK 162 + P+L +F +L S+ A QDFCVADL+ + PA + CK Sbjct: 7 IFPILFTFFLLLSSSNAAVQDFCVADLAAPEGPAGFSCK 45
>AB19A_PRUPE (Q9ZRA4) Auxin-binding protein ABP19a precursor| Length = 209 Score = 41.6 bits (96), Expect = 6e-04 Identities = 18/39 (46%), Positives = 23/39 (58%) Frame = +1 Query: 46 LLPVLISFLVLPFSAMALTQDFCVADLSCSDTPAXYPCK 162 + P+ +F +L S+ A QDFCVAD D PA Y CK Sbjct: 2 IFPIFFTFFLLLSSSHASVQDFCVADYKAPDGPAGYSCK 40
>AB19B_PRUPE (O04012) Auxin-binding protein ABP19b precursor| Length = 209 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +1 Query: 46 LLPVLISFLVLPFSAMALTQDFCVADLSCSDTPAXYPCK 162 + P+ +F +L ++ A QDFCVAD D PA Y CK Sbjct: 2 IFPIFFTFFLLLSTSHASVQDFCVADYKAPDGPAGYSCK 40
>GLT3_ARATH (Q9S772) Putative germin-like protein subfamily T member 3| precursor Length = 227 Score = 35.0 bits (79), Expect = 0.056 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +1 Query: 70 LVLPFSAMALTQDFCVADLSCSDTPAXYPCKT 165 L LP + QDFCVADL + T + YPCK+ Sbjct: 30 LSLPALKLNPFQDFCVADLQATPTNSGYPCKS 61
>GL31_ARATH (P94040) Germin-like protein subfamily 3 member 1 precursor| (AtGER1) (At-GERM1) (AtGLP1) Length = 208 Score = 35.0 bits (79), Expect = 0.056 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +1 Query: 94 ALTQDFCVADLSCSDTPAXYPC 159 A QDFCVA+L ++TPA YPC Sbjct: 17 ASVQDFCVANLKRAETPAGYPC 38
>GLP1_BRANA (P46271) Germin-like protein 1 precursor| Length = 207 Score = 34.3 bits (77), Expect = 0.095 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = +1 Query: 103 QDFCVADLSCSDTPAXYPC 159 QDFCVA+L ++TPA YPC Sbjct: 20 QDFCVANLKRAETPAGYPC 38
>GL23_ARATH (P93000) Germin-like protein subfamily 2 member 3 precursor| Length = 219 Score = 33.9 bits (76), Expect = 0.12 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 46 LLPVLISF-LVLPFSAMALT---QDFCVADLSCSDTPAXYPCK 162 ++P+ ++F LV A+A T QDFCVADLS YPCK Sbjct: 5 MIPIFVTFMLVAAHMALADTNMLQDFCVADLSNGLKVNGYPCK 47
>GLP1_SINAL (P45854) Germin-like protein 1 precursor| Length = 211 Score = 30.8 bits (68), Expect = 1.1 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +1 Query: 55 VLISFLVLPFSAM--ALTQDFCVADLSCSDTPAXYPCK 162 + I F++ FS++ A QDFCVAD P+ Y CK Sbjct: 5 IQIFFILSLFSSISFASVQDFCVADPKGPQNPSGYSCK 42
>GL25_ARATH (O65252) Probable germin-like protein subfamily 2 member 5| precursor Length = 213 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 49 LPVLISFLVLPFSAMALTQDFCVADLSCSDTPAXYPCK 162 L V+++ L + ++ + QD CVADLS + Y CK Sbjct: 8 LVVVVTMLFVAMASAEMLQDVCVADLSNAVKVNGYTCK 45
>GL33_ARATH (P94072) Germin-like protein subfamily 3 member 3 precursor| (AtGER3) (AtGLP2) Length = 211 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 88 AMALTQDFCVADLSCSDTPAXYPCK 162 + A QDFCVAD +P+ Y CK Sbjct: 18 SFASVQDFCVADPKGPQSPSGYSCK 42
>GLT2_ARATH (Q9LMC9) Germin-like protein subfamily T member 2 precursor| Length = 220 Score = 28.9 bits (63), Expect = 4.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 103 QDFCVADLSCSDTPAXYPCKT 165 QDFCV DL S + +PCK+ Sbjct: 34 QDFCVGDLKASPSINGFPCKS 54
>GLT1_ARATH (P92995) Germin-like protein subfamily T member 1 precursor| Length = 220 Score = 28.5 bits (62), Expect = 5.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 103 QDFCVADLSCSDTPAXYPCKT 165 QDFCV DL S + +PCK+ Sbjct: 34 QDFCVGDLKASASINGFPCKS 54
>HPCG_ECOLI (P42270) 2-oxo-hepta-3-ene-1,7-dioic acid hydratase (EC 4.2.-.-)| (OHED hydratase) Length = 264 Score = 28.1 bits (61), Expect = 6.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 140 VSLQDRSATQKSWVRAMAEKGRTRKEMRTG 51 ++++D A Q+ WVR +GRT K + G Sbjct: 34 ITIEDAYAVQREWVRLKIAEGRTLKGHKIG 63
>GL21_ARATH (P94014) Germin-like protein subfamily 2 member 1 precursor| Length = 207 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 46 LLPVLISFLVLPFSAMALTQDFCVADLSCSDTPAXYPCK 162 LL +SF + + + QD CVADL +PCK Sbjct: 10 LLLTTVSFFISSSADPDMLQDLCVADLPSGIKINGFPCK 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,018,958 Number of Sequences: 219361 Number of extensions: 152075 Number of successful extensions: 503 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)