| Clone Name | baet80c06 |
|---|---|
| Clone Library Name | barley_pub |
>THIM_CLOTE (Q893Q9) Hydroxyethylthiazole kinase (EC 2.7.1.50)| (4-methyl-5-beta-hydroxyethylthiazole kinase) (Thz kinase) (TH kinase) Length = 274 Score = 32.3 bits (72), Expect = 0.36 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +2 Query: 23 RGNFREAAAVSPQTAATSGLANQLTDATSPPHSRGRLAAAAGEPERRVVG 172 RGN E +S A+T G+ + D T+P R RL + E V+G Sbjct: 122 RGNISEVKVLSGMNASTKGVDAESWDETNPIEERIRLVKSLSEKYNAVIG 171
>SMAL1_BOVIN (Q9TTA5) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A-like protein 1 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 1) (DNA-dependent ATPase A) (HepA-related protein) Length = 941 Score = 29.3 bits (64), Expect = 3.0 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 10/59 (16%) Frame = +2 Query: 29 NFREAAAVS-------PQTAATSG---LANQLTDATSPPHSRGRLAAAAGEPERRVVGS 175 NF+E AA S P+ A G + Q + P + GRL AG P RVVGS Sbjct: 175 NFQETAASSCGQPPRDPELEARIGRPSTSGQNISGSVMPRTEGRLQQKAGTPLHRVVGS 233
>MTRB_MYCTU (Q50496) Sensor histidine kinase mtrB (EC 2.7.13.3)| Length = 567 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 4 IPAWGLPGEFPGSRRRLPANRGHKRIGQP 90 + AWG PGE R LP RGHK P Sbjct: 499 LEAWGEPGEGACFRLTLPMVRGHKVTTSP 527
>MTRB_MYCBO (P59963) Sensor histidine kinase mtrB (EC 2.7.13.3)| Length = 567 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 4 IPAWGLPGEFPGSRRRLPANRGHKRIGQP 90 + AWG PGE R LP RGHK P Sbjct: 499 LEAWGEPGEGACFRLTLPLVRGHKVTTSP 527
>MTRB_MYCLE (Q9CCJ1) Sensor histidine kinase mtrB (EC 2.7.13.3)| Length = 562 Score = 27.7 bits (60), Expect = 8.8 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +1 Query: 4 IPAWGLPGEFPGSRRRLPANRGHKRIGQPTDGRYLSSSLSRATCGG 141 + AWG PG+ R LP RGHK P + + +A+ G Sbjct: 499 LEAWGEPGQGACFRLTLPLVRGHKVTTSPLPMKPILQPSPQASTAG 544 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,580,656 Number of Sequences: 219361 Number of extensions: 381301 Number of successful extensions: 1528 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1525 length of database: 80,573,946 effective HSP length: 34 effective length of database: 73,115,672 effective search space used: 1754776128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)