| Clone Name | baet79h04 |
|---|---|
| Clone Library Name | barley_pub |
>IAAG_MAIZE (Q41819) Indole-3-acetate beta-glucosyltransferase (EC 2.4.1.121)| (IAA-Glu synthetase) ((Uridine 5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl transferase) Length = 471 Score = 45.4 bits (106), Expect = 4e-05 Identities = 18/27 (66%), Positives = 24/27 (88%) Frame = +1 Query: 154 HVLLLPYPSQGHVHPMLQFAKRLAHHG 234 HVL++P+P QGH++PM+QFAKRLA G Sbjct: 4 HVLVVPFPGQGHMNPMVQFAKRLASKG 30
>COGT2_ARATH (Q9SK82) Cytokinin-O-glucosyltransferase 2 (EC 2.4.1.-) (Zeatin| O-glucosyltransferase 2) Length = 489 Score = 38.5 bits (88), Expect = 0.005 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = +1 Query: 127 EVVTGTDGGHVLLLPYPSQGHVHPMLQFAKRLAHHG 234 +++ + HV+ +PYP+QGH++PM++ AK L G Sbjct: 4 QIIHNSQKPHVVCVPYPAQGHINPMMRVAKLLHARG 39
>HQGT_ARATH (Q9M156) Probable hydroquinone glucosyltransferase (EC 2.4.1.218)| (Arbutin synthase) Length = 480 Score = 37.4 bits (85), Expect = 0.010 Identities = 15/28 (53%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +1 Query: 154 HVLLLPYPSQGHVHPMLQFAKRLAH-HG 234 HV ++P P GH+ P+++FAKRL H HG Sbjct: 8 HVAIIPSPGMGHLIPLVEFAKRLVHLHG 35
>LGT_CITUN (Q9MB73) Limonoid UDP-glucosyltransferase (EC 2.4.1.210) (Limonoid| glucosyltransferase) (Limonoid GTase) (LGTase) Length = 511 Score = 33.5 bits (75), Expect = 0.15 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 154 HVLLLPYPSQGHVHPMLQFAKRLAHHG 234 HVLL+ +P GHV+P+L+ + LA G Sbjct: 8 HVLLVSFPGHGHVNPLLRLGRLLASKG 34
>HQGT_RAUSE (Q9AR73) Hydroquinone glucosyltransferase (EC 2.4.1.218) (Arbutin| synthase) Length = 470 Score = 32.7 bits (73), Expect = 0.26 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +1 Query: 154 HVLLLPYPSQGHVHPMLQFAKRL 222 H+ ++P P GH+ P+++FAKRL Sbjct: 6 HIAMVPTPGMGHLIPLVEFAKRL 28
>ZOX_PHAVU (P56725) Zeatin O-xylosyltransferase (EC 2.4.2.40) (Zeatin| O-beta-D-xylosyltransferase) Length = 454 Score = 32.3 bits (72), Expect = 0.34 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 157 VLLLPYPSQGHVHPMLQFAKRLA 225 VLLLP+P QGH++P LQ + +A Sbjct: 11 VLLLPFPVQGHLNPFLQLSHLIA 33
>UFOG_PETHY (Q43716) Anthocyanidin 3-O-glucosyltransferase (EC 2.4.1.115)| (Flavonol 3-O-glucosyltransferase) (UDP-glucose flavonoid 3-O-glucosyltransferase) (Anthocyanin rhamnosyl transferase) Length = 473 Score = 31.6 bits (70), Expect = 0.57 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 127 EVVTGTDGGHVLLLPYPSQGHVHPMLQFAKRLAHHG 234 E+ D HV++ P+ + GH+ P +Q A +L+ +G Sbjct: 4 EMKHSNDALHVVMFPFFAFGHISPFVQLANKLSSYG 39
>COGT1_ARATH (Q9ZQ99) Cytokinin-O-glucosyltransferase 1 (EC 2.4.1.-) (Zeatin| O-glucosyltransferase 1) (AtZOG1) Length = 491 Score = 31.2 bits (69), Expect = 0.75 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 154 HVLLLPYPSQGHVHPMLQFAKRLAHHG 234 H +L P+ +QGH+ PM+ A+ LA G Sbjct: 10 HFVLFPFMAQGHMIPMVDIARLLAQRG 36
>FOGT1_ARATH (Q9ZQ95) Flavonol-3-O-glycoside-7-O-glucosyltransferase 1 (EC| 2.4.1.-) Length = 495 Score = 31.2 bits (69), Expect = 0.75 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 154 HVLLLPYPSQGHVHPMLQFAKRLAHHG 234 H +L P+ +QGH+ PM+ A+ LA G Sbjct: 13 HFVLFPFMAQGHMIPMVDIARLLAQRG 39
>COGT3_ARATH (Q9ZQ94) Cytokinin-O-glucosyltransferase 3 (EC 2.4.1.-)| (UDP-glycosyltransferase 73C5) (Deoxynivalenol-glucosyl-transferase) (Zeatin O-glucosyltransferase 3) (AtZOG3) Length = 495 Score = 31.2 bits (69), Expect = 0.75 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 154 HVLLLPYPSQGHVHPMLQFAKRLAHHG 234 H +L P+ +QGH+ PM+ A+ LA G Sbjct: 12 HFVLFPFMAQGHMIPMVDIARLLAQRG 38
>CNGT1_ARATH (Q9FI99) Cytokinin-N-glucosyltransferase 1 (EC 2.4.1.-)| Length = 464 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 157 VLLLPYPSQGHVHPMLQFAKRLAHHG 234 V+L P P QG ++PMLQ AK L G Sbjct: 9 VILFPLPLQGCINPMLQLAKILYSRG 34
>PCSK9_HUMAN (Q8NBP7) Proprotein convertase subtilisin/kexin type 9 precursor| (EC 3.4.21.-) (Proprotein convertase PC9) (Subtilisin/kexin-like protease PC9) (Neural apoptosis-regulated convertase 1) (NARC-1) Length = 692 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 104 AMATCCLLDQASCALHVA 51 A+A CCLL QA+C++H A Sbjct: 522 AIARCCLLPQANCSVHTA 539
>FMFX_BORPE (P09808) Fimbrial protein fimX precursor (Pilin)| Length = 201 Score = 29.3 bits (64), Expect = 2.8 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 94 VAMASHGEDAQEVVTGTDGGHVLLLPYPSQGHV 192 VA+A+H ED V+TGT + PS G++ Sbjct: 15 VALAAHAEDGTIVITGTITDQTCTIEDPSPGYI 47
>MURG_ACIAD (Q6F703) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 365 Score = 29.3 bits (64), Expect = 2.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 154 HVLLLPYPSQGHVHPMLQFAKRLAHHG 234 HV+++ + GHV P L AK+L HG Sbjct: 11 HVMMMAAGTGGHVFPALAVAKQLQQHG 37
>CNGT2_ARATH (Q9FIA0) Cytokinin-N-glucosyltransferase 2 (EC 2.4.1.-)| Length = 450 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 145 DGGHVLLLPYPSQGHVHPMLQFAKRLAHHG 234 +G V+L P P QG ++PMLQ A L G Sbjct: 6 NGLRVILFPLPLQGCINPMLQLANILHVRG 35
>UFOG5_MANES (Q40287) Anthocyanidin 3-O-glucosyltransferase (EC 2.4.1.115)| (Flavonol 3-O-glucosyltransferase 5) (UDP-glucose flavonoid 3-O-glucosyltransferase 5) Length = 487 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 154 HVLLLPYPSQGHVHPMLQFAKRL 222 H++LL P GH+ P+L+ KR+ Sbjct: 11 HIVLLSSPGLGHLIPVLELGKRI 33
>ANGLT_ROSHC (Q4R1I9) Anthocyanidin 5,3-O-glucosyltransferase (EC 2.4.1.-)| (UDP-glucose: anthocyanidin 5,3-O-glucosyltransferase) Length = 473 Score = 27.7 bits (60), Expect = 8.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 148 GGHVLLLPYPSQGHVHPMLQFAKRLAHH 231 G ++L PYP GH+ M++ K L H Sbjct: 3 GDAIVLYPYPGLGHLISMVELGKLLLTH 30 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,447,444 Number of Sequences: 219361 Number of extensions: 329788 Number of successful extensions: 1139 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1139 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)