| Clone Name | baet79e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATG4D_PIG (Q684M2) Cysteine protease ATG4D (EC 3.4.22.-) (Autoph... | 28 | 5.0 | 2 | FMO5_RABIT (Q04799) Dimethylaniline monooxygenase [N-oxide-formi... | 28 | 6.5 | 3 | FMO5_RAT (Q8K4C0) Dimethylaniline monooxygenase [N-oxide-forming... | 28 | 8.4 |
|---|
>ATG4D_PIG (Q684M2) Cysteine protease ATG4D (EC 3.4.22.-) (Autophagy-related| protein 4 homolog D) Length = 469 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 6/29 (20%) Frame = -1 Query: 207 TPSRRRGHAHWL------GAPRLHRARRH 139 +P+R RG AHW+ AP L + RRH Sbjct: 179 SPNRYRGPAHWMPPHWVQAAPELEQERRH 207
>FMO5_RABIT (Q04799) Dimethylaniline monooxygenase [N-oxide-forming] 5 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 5) (FMO 5) (Dimethylaniline oxidase 5) (FMO 1C1) (FMO form 3) Length = 532 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +3 Query: 54 YQSLKDTGRGNQIVSSIISTAKQCNLDKDVALPDEGEELPANERDLVVGKVYGK 215 +Q D GR + S II+T+K+ D +PD N + L ++Y K Sbjct: 43 FQESPDEGRASIYKSVIINTSKEMMCFSDYPIPDHFPNFMHNSQVLEYFRMYAK 96
>FMO5_RAT (Q8K4C0) Dimethylaniline monooxygenase [N-oxide-forming] 5 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 5) (FMO 5) (Dimethylaniline oxidase 5) Length = 532 Score = 27.7 bits (60), Expect = 8.4 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +3 Query: 54 YQSLKDTGRGNQIVSSIISTAKQCNLDKDVALPDEGEELPANERDLVVGKVYGK 215 YQ + GR + S II+T+K+ D +PD N + L ++Y K Sbjct: 43 YQENPEKGRASIYKSVIINTSKEMMCFSDYPIPDHYPNFMHNSQVLEYFRMYAK 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,907,945 Number of Sequences: 219361 Number of extensions: 538824 Number of successful extensions: 1531 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1531 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)