| Clone Name | baet78g11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PDLI2_RAT (Q6AYD6) PDZ and LIM domain protein 2 | 31 | 0.79 | 2 | FCA_ARATH (O04425) Flowering time control protein FCA | 29 | 3.0 |
|---|
>PDLI2_RAT (Q6AYD6) PDZ and LIM domain protein 2| Length = 349 Score = 31.2 bits (69), Expect = 0.79 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = +3 Query: 3 TSQQARSERGESKSQDSTFLSLLSAPGRAQDTRYPSLPRLSS 128 TSQQA G S DST LL +PGR PS PRLSS Sbjct: 179 TSQQA----GHSSPSDSTVRVLLHSPGR------PSSPRLSS 210
>FCA_ARATH (O04425) Flowering time control protein FCA| Length = 747 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 9 QQARSERGESKSQDSTFLSLLSAPGRAQDTRYPSLP 116 QQ + + + Q + SL PG + +T+YPSLP Sbjct: 659 QQVQQQYQGQQLQQPFYSSLYPTPGASHNTQYPSLP 694 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,003,506 Number of Sequences: 219361 Number of extensions: 236303 Number of successful extensions: 871 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)