| Clone Name | baet78f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloropla... | 35 | 0.052 | 2 | SYE1_WOLPM (Q73HV5) Glutamyl-tRNA synthetase 1 (EC 6.1.1.17) (Gl... | 29 | 2.9 | 3 | OMPY_CHLPN (Q9Z6M5) Putative outer membrane protein CPn_1034/CP0... | 29 | 3.7 | 4 | ARMX1_RAT (Q5U310) Armadillo repeat-containing X-linked protein 1 | 28 | 8.3 |
|---|
>CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCI type III CAB-8) Length = 273 Score = 35.0 bits (79), Expect = 0.052 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 173 FVVRASSSPPAKQK*HRQLWF 235 FVVRA+S+PP KQ +RQLWF Sbjct: 37 FVVRAASTPPVKQGANRQLWF 57
>SYE1_WOLPM (Q73HV5) Glutamyl-tRNA synthetase 1 (EC 6.1.1.17) (Glutamate--tRNA| ligase 1) (GluRS 1) Length = 473 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -2 Query: 192 DDALTTKGDFREEDDLEKEDCRGLPSSCLPERRPW 88 D+ K REE + K C P SC P R W Sbjct: 104 DEVAEKKAKAREEGKIYKHKCTTKPPSCHPSSRHW 138
>OMPY_CHLPN (Q9Z6M5) Putative outer membrane protein| CPn_1034/CP0818/CPj1034/CpB1074 precursor Length = 262 Score = 28.9 bits (63), Expect = 3.7 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -2 Query: 216 HFCLAGGLDDALTTKGDFREEDDLEKEDCRGLPSSCLPERRPWAAIVP 73 +F L LDD L G+ + + +GL PE+ W A+VP Sbjct: 41 NFWLILDLDDTLLQGGEALSHSIWKSKAIQGLQKQGTPEQEAWEAVVP 88
>ARMX1_RAT (Q5U310) Armadillo repeat-containing X-linked protein 1| Length = 461 Score = 27.7 bits (60), Expect = 8.3 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 228 SCLCHFCLAGGLDDALTTKGDFREEDDLEKEDCRGLP 118 +C C + L G D+ D EE++ E+E C G P Sbjct: 20 ACYCVYRLTWGKDENEKLWDDEDEEEEEEEESCSGKP 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,124,106 Number of Sequences: 219361 Number of extensions: 393929 Number of successful extensions: 1262 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1262 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)