| Clone Name | baet78d09 |
|---|---|
| Clone Library Name | barley_pub |
>NUP88_RAT (O08658) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) (Nucleoporin Nup84) Length = 742 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 46 VMEVEIR*GVCNNSPAESTSPENGWR*SARPTPGHLGERH 165 V+ + +R G+ N SPAE+ P S P P HL R+ Sbjct: 22 VVFLRLREGLKNQSPAEADKPATSTSPSCPPLPPHLPTRN 61
>SYQ_CHRVO (Q7NX86) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glutamine--tRNA| ligase) (GlnRS) Length = 560 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 7/30 (23%) Frame = -2 Query: 81 VTHSLADFDFHDHRPA-------VLIDQHP 13 +THSL +F DHRP + I+ HP Sbjct: 227 ITHSLCSLEFEDHRPLYDWVLDNISIEHHP 256
>PGMI_AERPE (Q9YE01) Bifunctional phosphoglucose/phosphomannose isomerase| (Glucose-6-phosphate isomerase) (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Mannose-6-phosphate isomerase) (EC 5.3.1.8) (Phosphomannose isomerase) (PMI) Length = 335 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 9/33 (27%) Frame = -2 Query: 195 RPPRPPTHR--GMALAQMAG-------CGSRAS 124 RPPRPP HR G+ LA +G CGS S Sbjct: 70 RPPRPPRHRGYGLVLASYSGNTLETVECGSLLS 102
>OPA1_MOUSE (P58281) Dynamin-like 120 kDa protein, mitochondrial precursor| (Large GTP-binding protein) (LargeG) Length = 960 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 41 RWS-WKSKSAKECVTTHLPNQLAPKMDGAEARDPHPAIWAS 160 RW WK+++ ++CV N+L + + D HPA AS Sbjct: 774 RWMYWKNRTQEQCVHNETKNELEKML---KVNDEHPAYLAS 811
>CYSH_NEIMA (Q9JUD5) Phosphoadenosine phosphosulfate reductase (EC 1.8.4.8)| (PAPS reductase, thioredoxin dependent) (PAdoPS reductase) (3'-phosphoadenylylsulfate reductase) (PAPS sulfotransferase) Length = 244 Score = 28.1 bits (61), Expect = 6.5 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 35 AGRWSWKSKSAKEC 76 AGRW W+ K++KEC Sbjct: 227 AGRWWWEDKNSKEC 240
>CAP16_ARATH (Q8L936) Putative clathrin assembly protein At4g40080| Length = 365 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 192 PPRPPTHRGMALAQMAGCGSRASAPS 115 P PP +R +A+ AG GSRA+A S Sbjct: 49 PSTPPGNRHLAVILSAGTGSRATASS 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,896,165 Number of Sequences: 219361 Number of extensions: 665357 Number of successful extensions: 1947 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1946 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)