| Clone Name | baet76e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1728_MYCBO (P64886) Hypothetical protein Rv1792c/MT1741/Mb1728c | 30 | 1.2 | 2 | Y1702_MYCTU (P64885) Hypothetical protein Rv1792c/MT1741/Mb1728c | 30 | 1.2 | 3 | S39A5_HUMAN (Q6ZMH5) Zinc transporter ZIP5 precursor (Solute car... | 28 | 7.7 | 4 | K0415_HUMAN (O43299) Protein KIAA0415 (Fragment) | 28 | 7.7 |
|---|
>Y1728_MYCBO (P64886) Hypothetical protein Rv1792c/MT1741/Mb1728c| Length = 454 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -3 Query: 293 PCVTLVLDCLLRPLPVSVDDELRHAALRIMLSMSGRFRPPQ 171 P V+ C L LP VD R A + ++ GRFRP Q Sbjct: 128 PAHVQVIRCFLHQLPHHVDLPTREKAEAELATLGGRFRPDQ 168
>Y1702_MYCTU (P64885) Hypothetical protein Rv1792c/MT1741/Mb1728c| Length = 454 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -3 Query: 293 PCVTLVLDCLLRPLPVSVDDELRHAALRIMLSMSGRFRPPQ 171 P V+ C L LP VD R A + ++ GRFRP Q Sbjct: 128 PAHVQVIRCFLHQLPHHVDLPTREKAEAELATLGGRFRPDQ 168
>S39A5_HUMAN (Q6ZMH5) Zinc transporter ZIP5 precursor (Solute carrier family 39| member 5) Length = 539 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 79 KKHEQPPPARAPAGH-SHKTGRKGET 5 +K+ Q PPA AP GH H G +G T Sbjct: 355 EKNSQHPPALAPPGHQGHSHGHQGGT 380
>K0415_HUMAN (O43299) Protein KIAA0415 (Fragment)| Length = 634 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -3 Query: 293 PCVTLVLDCLLRPLPVSVDDELRHAALRIMLSMSGRFRPPQ 171 PC+T VLD LR P + + L +LR + FR PQ Sbjct: 495 PCLTAVLDLQLRSAPAASERPLWDTSLRAPSCLEA-FRDPQ 534 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,575,355 Number of Sequences: 219361 Number of extensions: 513130 Number of successful extensions: 2034 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2033 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)