| Clone Name | baet76b06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHER1_VIBCH (Q9KQ06) Chemotaxis protein methyltransferase 1 (EC ... | 29 | 4.9 |
|---|
>CHER1_VIBCH (Q9KQ06) Chemotaxis protein methyltransferase 1 (EC 2.1.1.80)| Length = 275 Score = 28.9 bits (63), Expect = 4.9 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = -2 Query: 278 RMVRFWSA----GQAPYQIGWTVMSA--ARTGPMWYSSLTRSDDPSNFLDAPRA 135 R ++ WSA GQ PY + T++ R G + S+T +D ++ LD RA Sbjct: 103 RPIKIWSAASSSGQEPYSMAMTILEVQQKRPGLLPSVSITATDISASMLDMCRA 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,202,240 Number of Sequences: 219361 Number of extensions: 343838 Number of successful extensions: 1183 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1183 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)