| Clone Name | baet76a08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TL17_ARATH (P81760) Thylakoid lumenal 17.4 kDa protein, chloropl... | 34 | 0.083 | 2 | TL17_SPIOL (P81778) Thylakoid lumenal 17.4 kDa protein (P17.4) (... | 34 | 0.11 | 3 | IRS1_HUMAN (P35568) Insulin receptor substrate 1 (IRS-1) | 31 | 0.70 | 4 | IRS1_CERAE (Q28224) Insulin receptor substrate 1 (IRS-1) | 31 | 0.70 | 5 | IRS1_MOUSE (P35569) Insulin receptor substrate 1 (IRS-1) | 28 | 4.5 | 6 | IRS1_RAT (P35570) Insulin receptor substrate 1 (IRS-1) (pp185) | 28 | 4.5 | 7 | RTBDN_SPETR (Q5DRQ5) Retbindin precursor | 28 | 5.9 |
|---|
>TL17_ARATH (P81760) Thylakoid lumenal 17.4 kDa protein, chloroplast precursor| (P17.4) Length = 236 Score = 34.3 bits (77), Expect = 0.083 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 248 QRLPPLSTDPKRCEAAF 298 QRLPPLST+P RCE AF Sbjct: 80 QRLPPLSTEPDRCEKAF 96
>TL17_SPIOL (P81778) Thylakoid lumenal 17.4 kDa protein (P17.4) (Fragment)| Length = 23 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +2 Query: 248 QRLPPLSTDPKRCEAAF 298 QRLPPLS DP RCE AF Sbjct: 3 QRLPPLSNDPDRCERAF 19
>IRS1_HUMAN (P35568) Insulin receptor substrate 1 (IRS-1)| Length = 1242 Score = 31.2 bits (69), Expect = 0.70 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 52 RLAGHRARRLCSTPTAPAEGVPRHVLGRRGG 144 RL GHR T + P EG+ H L RRGG Sbjct: 567 RLPGHRHSAFVPTRSYPEEGLEMHPLERRGG 597
>IRS1_CERAE (Q28224) Insulin receptor substrate 1 (IRS-1)| Length = 1251 Score = 31.2 bits (69), Expect = 0.70 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 52 RLAGHRARRLCSTPTAPAEGVPRHVLGRRGG 144 RL GHR T + P EG+ H L RRGG Sbjct: 567 RLPGHRHSAFVPTHSYPEEGLEMHPLERRGG 597
>IRS1_MOUSE (P35569) Insulin receptor substrate 1 (IRS-1)| Length = 1233 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 52 RLAGHRARRLCSTPTAPAEGVPRHVLGRRGG 144 RL G+R T + P EG+ H L RRGG Sbjct: 563 RLPGYRHSAFVPTHSYPEEGLEMHHLERRGG 593
>IRS1_RAT (P35570) Insulin receptor substrate 1 (IRS-1) (pp185)| Length = 1235 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 52 RLAGHRARRLCSTPTAPAEGVPRHVLGRRGG 144 RL G+R T + P EG+ H L RRGG Sbjct: 563 RLPGYRHSAFVPTHSYPEEGLEMHHLERRGG 593
>RTBDN_SPETR (Q5DRQ5) Retbindin precursor| Length = 254 Score = 28.1 bits (61), Expect = 5.9 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +2 Query: 17 SPHCIDMVSSCLASPATARGGSALRLQLQPRGCRVTCLADAGGAGSG 157 S HC+++ S L P R Q R R T + DAGG+GSG Sbjct: 203 SRHCLNISISLLPRPRPGRWARETISQRSRR--RGTGILDAGGSGSG 247 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,158,656 Number of Sequences: 219361 Number of extensions: 485584 Number of successful extensions: 1918 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1918 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)