| Clone Name | baet76a06 |
|---|---|
| Clone Library Name | barley_pub |
>PMP21_CHLPN (Q9Z6U5) Probable outer membrane protein pmp21 precursor (Polymorphic| membrane protein 21) Length = 1609 Score = 28.5 bits (62), Expect = 4.1 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 14/72 (19%) Frame = +2 Query: 56 NLTDQTQSLSFSRTHTTVG-----SQSGPRTIDGRQAFLGAE------AQNQGHRGGGCL 202 N+TD ++SFS+ T +G + G TI G Q + + ++NQ GG + Sbjct: 803 NITDNGSAVSFSKNRTRLGGAGVAAPQGSVTICGNQGNIAFKENFVFGSENQRSGGGAII 862 Query: 203 ASAG---KDDAG 229 A++ +D+AG Sbjct: 863 ANSSVNIQDNAG 874
>WBS27_HUMAN (Q8N6F8) Williams-Beuren syndrome chromosome region 27 protein| Length = 245 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 192 PPRWPWFWASAPRKACRPSM 133 PP W W+ AS PR A P++ Sbjct: 212 PPSWWWYPASLPRMASSPAL 231
>VSX1_BOVIN (Q9GMA3) Visual system homeobox 1 (Transcription factor VSX1)| (Retinal inner nuclear layer homeobox protein) (Homeodomain protein RINX) Length = 365 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 361 PEHPLPLRCRFRGAPPPRCCR 299 PE P PL RF G PPP R Sbjct: 111 PEGPEPLAPRFPGRPPPSAAR 131
>PQQE_RHOPA (Q6N8F3) Coenzyme PQQ synthesis protein E (Pyrroloquinoline quinone| biosynthesis protein E) Length = 377 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 171 WASAPRKACRPSMVLGPDCEPTVVCVREKLK 79 WA R A P++ DC TV RE+LK Sbjct: 196 WALKNRAALMPTLAQIEDCTATVEAARERLK 226
>ATG13_KLULA (Q6CWK2) Autophagy-related protein 13| Length = 684 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 140 HRWFLVPTVSRPWCVSERSLKTGFDLSNWQVEMERQ 33 H +L PW V + KT L W VE+++Q Sbjct: 89 HMVYLHDADGNPWMVCKGGKKTEIVLERWLVELDKQ 124
>GUXB_CELFI (P50899) Exoglucanase B precursor (EC 3.2.1.91)| (Exocellobiohydrolase B) (1,4-beta-cellobiohydrolase B) (CBP120) Length = 1090 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 107 PWCVSERSLKTGFDLSNWQVEMERQWQGSR*LWNA 3 PW V+ S D ++W+V E +W G WNA Sbjct: 504 PWVVANIST----DGASWKVPSELKWTGKPDTWNA 534 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,345,082 Number of Sequences: 219361 Number of extensions: 574938 Number of successful extensions: 1962 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1961 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)