| Clone Name | baet75h02 |
|---|---|
| Clone Library Name | barley_pub |
>BSN_HUMAN (Q9UPA5) Bassoon protein (Zinc-finger protein 231)| Length = 3925 Score = 32.0 bits (71), Expect = 0.61 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 261 PRPHGSPLPPVATTSDTLCSSSSM 190 PRP G PLPP T CSS SM Sbjct: 3513 PRPAGGPLPPGGDTCPQFCSSHSM 3536
>SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouch) (Homeobox| protein NK-1) Length = 659 Score = 31.2 bits (69), Expect = 1.0 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = -2 Query: 261 PRPHGSPLPPVATTSDTLCSSSSM*MEPNPAKKPITDDSAPVMEARDHSRP 109 P PH P P + SSS P+PA P++ ++P M + P Sbjct: 224 PHPHPHPHPHPSAVFHLRAPSSSSTAPPSPATSPLSPPTSPAMHSDQQMSP 274
>SF01_MOUSE (Q64213) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (mZFM) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) (CW17) Length = 653 Score = 31.2 bits (69), Expect = 1.0 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = -2 Query: 261 PRPHGSPLPPVATTSDTLC---SSSSM*MEPNPAKK-PITDDSAPVMEARDHSRP 109 P P G+P PP + LC S +S+ + PN A + P P E+ D RP Sbjct: 576 PLPPGAPPPPTCSIECLLCLLSSPNSLCLSPNRAARIPPRGSDGPSHESEDFPRP 630
>UBP28_MOUSE (Q5I043) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1051 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 284 TPNKKLETPAPMAPRFLQSQRPQTPFVVVVVCRW 183 +P+ LETPAP APR + + + FV + RW Sbjct: 522 SPHSSLETPAPPAPRTVTDE--EMNFVKTCLQRW 553
>HCN2_RAT (Q9JKA9) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 2 Length = 863 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -2 Query: 255 PHGSPLPPVATTSDTLCSSSSM*MEPNPAKKPITDDSAPVMEARDHSRP 109 PHG+P P A ++ SS+ P P T +AP + RD + P Sbjct: 800 PHGAPAPSPAASARPASSST-----PRLGPAPTTRTAAPSPDRRDSASP 843
>PCGF2_MOUSE (P23798) Polycomb group RING finger protein 2 (DNA-binding protein| Mel-18) (RING finger protein 110) (Zinc finger protein 144) (Zfp-144) Length = 342 Score = 28.1 bits (61), Expect = 8.8 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = -2 Query: 240 LPPVATTSDTLCSSSSM*ME------PNPAKKPITDDSAPVMEARDHSRPSTNG 97 LP V T S+ +S + E P+PA P T S P H PS++G Sbjct: 238 LPTVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHG 291
>GATA_METTH (O27540) Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.-)| (Glu-ADT subunit A) Length = 454 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = -2 Query: 162 PITDDSAPVMEARDHSRPSTNGILREFVPLHRKAMNECVVGE 37 P T DS+P +E + G++REF+ + +A++E + G+ Sbjct: 236 PTTLDSSPDLEVERELKGLRVGVVREFLEVTDEAIDEVIQGK 277 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,689,082 Number of Sequences: 219361 Number of extensions: 906869 Number of successful extensions: 2821 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2817 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)