| Clone Name | baet75g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ARCA_SALTY (Q8ZK33) Arginine deiminase (EC 3.5.3.6) (ADI) (Argin... | 28 | 5.8 | 2 | ARCA_SALTI (Q8Z125) Arginine deiminase (EC 3.5.3.6) (ADI) (Argin... | 28 | 5.8 | 3 | Y1184_SYNP6 (P08442) Hypothetical protein syc1184_c | 27 | 9.9 |
|---|
>ARCA_SALTY (Q8ZK33) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 406 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 222 LDSGNHDHHPYPSSAADPSAWIAAFPQHQLAYQL 121 LD+ D+ P+ AAD AW+A P +LA L Sbjct: 86 LDTQISDYRLGPTFAADIRAWLADMPHRELARHL 119
>ARCA_SALTI (Q8Z125) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 406 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 222 LDSGNHDHHPYPSSAADPSAWIAAFPQHQLAYQL 121 LD+ D+ P+ AAD AW+A P +LA L Sbjct: 86 LDTQISDYRLGPTFAADIRAWLADMPHRELARHL 119
>Y1184_SYNP6 (P08442) Hypothetical protein syc1184_c| Length = 417 Score = 27.3 bits (59), Expect = 9.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 212 PLSNWAWHA*SCYAWCWG 265 P NW WH S YA+C G Sbjct: 48 PGYNWRWHYPSAYAFCTG 65 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,491,093 Number of Sequences: 219361 Number of extensions: 583232 Number of successful extensions: 1662 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1661 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)