ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet73f09 |
|---|---|
| Clone Library Name | barley_pub |
>TR240_HUMAN (Q9UHV7) Thyroid hormone receptor-associated protein complex 240 kDa| component (Trap240) (Thyroid hormone receptor-associated protein 1) (Vitamin D3 receptor-interacting protein complex component DRIP250) (DRIP 250) (Activator-recruited cofac Length = 2174 Score = 32.0 bits (71), Expect = 0.74 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +3 Query: 273 VWWLNALKCFLRSRGRM*GPPAVGTKVNLPSEPCKRLLQ*ILQSNQPVLP 422 VW L L+CFL + PP + + V++ PC+ LLQ + ++ + P Sbjct: 1661 VWTLGLLRCFLEMVQTL--PPHIKSTVSVQIIPCQYLLQPVKHEDREIYP 1708
>SIN3B_MOUSE (Q62141) Paired amphipathic helix protein Sin3b (Transcriptional| corepressor Sin3b) (Histone deacetylase complex subunit Sin3b) Length = 1098 Score = 30.8 bits (68), Expect = 1.7 Identities = 18/66 (27%), Positives = 39/66 (59%), Gaps = 12/66 (18%) Frame = +2 Query: 155 RYLEAYDVHRS----LQTFEQNRLET--------ANEEVASKISTIARWREGLVAKCLEM 298 R+L+ +++RS L T+++ +L T + EEV ++++ + R +E L+++ + Sbjct: 167 RFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQF 226 Query: 299 LPEVQR 316 LPE +R Sbjct: 227 LPEAKR 232
>SIN3B_HUMAN (O75182) Paired amphipathic helix protein Sin3b (Transcriptional| corepressor Sin3b) (Histone deacetylase complex subunit Sin3b) Length = 1162 Score = 30.8 bits (68), Expect = 1.7 Identities = 18/66 (27%), Positives = 39/66 (59%), Gaps = 12/66 (18%) Frame = +2 Query: 155 RYLEAYDVHRS----LQTFEQNRLET--------ANEEVASKISTIARWREGLVAKCLEM 298 R+L+ +++RS L T+++ +L T + EEV ++++ + R +E L+++ + Sbjct: 175 RFLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQF 234 Query: 299 LPEVQR 316 LPE +R Sbjct: 235 LPEAKR 240
>PGK_MYCGA (Q7NBG7) Phosphoglycerate kinase (EC 2.7.2.3)| Length = 413 Score = 30.8 bits (68), Expect = 1.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +2 Query: 200 EQNRLETANEEVASKISTIARWREGLVAKCLEMLPEVQREDVRSTSSGDQS 352 + N++ A +++ +K STI + KC+ E + ED + GD+S Sbjct: 269 KDNKIILATDQMVTKASTITDIKTAPAGKCVFAKDEAENEDFEALDIGDES 319
>ASSY_BUCBP (P59412) Argininosuccinate synthase (EC 6.3.4.5)| (Citrulline--aspartate ligase) Length = 409 Score = 30.0 bits (66), Expect = 2.8 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +2 Query: 200 EQNRLETANEEVASKISTIARWREGLVAKCLEMLPEVQREDVRSTSS 340 +Q R ETA +A ++ IA WRE E+L ++ ++V++T+S Sbjct: 128 DQVRFETAYVGLAPELKIIAPWREWSFKSRGELLSYLKEKNVKTTAS 174
>AMOL2_MOUSE (Q8K371) Angiomotin-like protein 2| Length = 772 Score = 29.3 bits (64), Expect = 4.8 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +2 Query: 182 RSLQTFEQN---RLETANEEVASKISTIARWREGLVAKCLEMLPEVQRE 319 R LQ F ++ RLE+AN +ASK + +VAK L E Q+E Sbjct: 381 RRLQDFNRDLRERLESANRHLASKTQEAQAGSQDMVAKLLAQSYEQQQE 429
>OSTK_BOVIN (P31098) Osteopontin-K precursor| Length = 277 Score = 29.3 bits (64), Expect = 4.8 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 322 CEVHQQWGPKSICHPNHANVFSSESCSQISQFYHWIEPVL 441 CE+ ++ PK+ H+N+ S+ S++SQ +H +E L Sbjct: 210 CELSKELMPKAKDKNKHSNLIESQENSKLSQEFHSLEDKL 249
>CHIF_DROME (Q9NK54) Protein chiffon| Length = 1711 Score = 29.3 bits (64), Expect = 4.8 Identities = 26/81 (32%), Positives = 32/81 (39%) Frame = +2 Query: 143 LQRYRYLEAYDVHRSLQTFEQNRLETANEEVASKISTIARWREGLVAKCLEMLPEVQRED 322 LQRY+ + LQ E N L TA + SK ST PE+ + Sbjct: 950 LQRYQQEQ-----EQLQQLEGNSLATAGAKCDSKAST----------------PELLERE 988 Query: 323 VRSTSSGDQSQFAIRTMQTSS 385 S S GD+ Q R TSS Sbjct: 989 FASGSMGDRVQLIERVRSTSS 1009
>MOLR_ECOLI (P33345) Molybdate metabolism regulator| Length = 1264 Score = 29.3 bits (64), Expect = 4.8 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = +2 Query: 140 YLQRYRYLEAYDVHRSLQTFEQNRLETANEEVASKISTIARWREGLVAKCLEMLPEVQRE 319 YL++Y E + + L E++ + +++ + I I WR+ L+A L PE+ E Sbjct: 266 YLEQYSRFEXR-LRKHLSLTEESLWQKCAQKLIAAIPHIPEWRQPLIALLLPEKPEIAHE 324
>OSP_DROME (Q27421) Protein outspread| Length = 1553 Score = 29.3 bits (64), Expect = 4.8 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 12/40 (30%) Frame = +3 Query: 237 HPKSVQLLGGEKV------------WWLNALKCFLRSRGR 320 HP S+ + E+V WWLN L F +S+GR Sbjct: 142 HPNSIAITAPERVTFVKGTSSEESQWWLNILAAFPKSKGR 181
>AMOL2_HUMAN (Q9Y2J4) Angiomotin-like protein 2 (Leman coiled-coil protein)| (LCCP) Length = 779 Score = 29.3 bits (64), Expect = 4.8 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +2 Query: 182 RSLQTFEQN---RLETANEEVASKISTIARWREGLVAKCLEMLPEVQRE 319 R LQ F ++ RLE+AN +ASK + +VAK L E Q+E Sbjct: 385 RRLQDFNRDLRERLESANRRLASKTQEAQAGSQDMVAKLLAQSYEQQQE 433
>LUXQ_VIBVY (Q7MD16) Autoinducer 2 sensor kinase/phosphatase luxQ (EC 2.7.13.3)| (EC 3.1.3.-) Length = 857 Score = 28.9 bits (63), Expect = 6.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 86 QRGTCEDISLPQNPKADQLFYQ 21 ++G CE+ P NPK +QLF Q Sbjct: 711 EKGECEEQKTPTNPKPEQLFGQ 732
>LUXQ_VIBVU (Q8D5Z6) Autoinducer 2 sensor kinase/phosphatase luxQ (EC 2.7.13.3)| (EC 3.1.3.-) Length = 857 Score = 28.9 bits (63), Expect = 6.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 86 QRGTCEDISLPQNPKADQLFYQ 21 ++G CE+ P NPK +QLF Q Sbjct: 711 EKGECEEQKTPTNPKPEQLFGQ 732 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,121,578 Number of Sequences: 219361 Number of extensions: 1641050 Number of successful extensions: 5251 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 5086 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5249 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
