| Clone Name | baet73b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYS_MANSM (Q65SK3) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--... | 28 | 4.3 | 2 | XBP1_HUMAN (P17861) X box-binding protein 1 (XBP-1) (Tax-respons... | 28 | 7.3 | 3 | DAPB_PROMA (Q7VC38) Dihydrodipicolinate reductase (EC 1.3.1.26) ... | 27 | 9.5 | 4 | PHR_ECOLI (P00914) Deoxyribodipyrimidine photo-lyase (EC 4.1.99.... | 27 | 9.5 |
|---|
>SYS_MANSM (Q65SK3) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +3 Query: 198 EEAFKALQVAIKCRNSAGEYESKAVGALDGTGAFSVPLAADL 323 EE KALQV + + SKAVGA G PL A++ Sbjct: 35 EEQRKALQVETETLQAKRNARSKAVGAAKARGENIAPLLAEM 76
>XBP1_HUMAN (P17861) X box-binding protein 1 (XBP-1) (Tax-responsive| element-binding protein 5) Length = 261 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 5/31 (16%) Frame = -3 Query: 349 SCATQSAP-----WRSAARGTLKAPVPSRAP 272 SC++ + P WRS+ R T K PVP + P Sbjct: 214 SCSSNALPQSLPAWRSSQRSTQKDPVPYQPP 244
>DAPB_PROMA (Q7VC38) Dihydrodipicolinate reductase (EC 1.3.1.26) (DHPR)| Length = 276 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 5/53 (9%) Frame = +3 Query: 201 EAFKALQVAIKCR-----NSAGEYESKAVGALDGTGAFSVPLAADLHGADCVA 344 E KA+ + C ++A E E +G G V + ADL G+ CVA Sbjct: 18 EVIKAIYKSNDCELVAAIDNANEMEGVDIGTALGMDQMDVAVTADLEGSLCVA 70
>PHR_ECOLI (P00914) Deoxyribodipyrimidine photo-lyase (EC 4.1.99.3) (DNA| photolyase) (Photoreactivating enzyme) Length = 472 Score = 27.3 bits (59), Expect = 9.5 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 198 EEAFKALQVAIKCRNSAGEYE-SKAVGALDGTGAFSVPLA 314 EE Q+ C+N AGEYE + A++GT S LA Sbjct: 204 EEKAAIAQLRQFCQNGAGEYEQQRDFPAVEGTSRLSASLA 243 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.125 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,954,872 Number of Sequences: 219361 Number of extensions: 438996 Number of successful extensions: 1754 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1754 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)