| Clone Name | baet72e07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RK1_PEA (P49208) 50S ribosomal protein L1, chloroplast precursor... | 54 | 3e-07 | 2 | RL1_THEMA (P29393) 50S ribosomal protein L1 | 30 | 3.3 | 3 | CS021_MOUSE (Q9D279) Protein C19orf21 homolog | 28 | 9.7 |
|---|
>RK1_PEA (P49208) 50S ribosomal protein L1, chloroplast precursor (Fragment)| Length = 208 Score = 53.5 bits (127), Expect = 3e-07 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = +2 Query: 341 APTRPRTGKAALPLKRDRTRSKRYLEIQKLREKQKEYDVPMAISLM 478 +P R GK LK DR RSKR+LEIQKLRE +KEYD+ AISL+ Sbjct: 37 SPLSLRQGKLHWRLKSDRVRSKRFLEIQKLRELKKEYDLKTAISLV 82
>RL1_THEMA (P29393) 50S ribosomal protein L1| Length = 233 Score = 30.0 bits (66), Expect = 3.3 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 401 SKRYLEIQKLREKQKEYDVPMAISLM 478 SKRYLE +KL ++ K YD+ AI L+ Sbjct: 5 SKRYLEARKLVDRTKYYDLDEAIELV 30
>CS021_MOUSE (Q9D279) Protein C19orf21 homolog| Length = 648 Score = 28.5 bits (62), Expect = 9.7 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = +2 Query: 344 PTRPRTGKAAL---PLKRDRTRSKRYLEIQKLREKQKEYD 454 P+RP K +L P +RDR R Y++ ++E Q+E D Sbjct: 295 PSRPLLSKMSLTETPPRRDRGRPSLYVQRDMVQETQREED 334 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,616,670 Number of Sequences: 219361 Number of extensions: 140732 Number of successful extensions: 569 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)