| Clone Name | baet72c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DACT1_HUMAN (Q9NYF0) Dapper homolog 1 (hDPR1) (Heptacellular car... | 32 | 0.76 | 2 | AFR_ARATH (Q8LAW2) Protein AFR (Protein ATTENUATED FAR-RED RESPO... | 31 | 1.3 | 3 | DACT1_MOUSE (Q8R4A3) Dapper homolog 1 (MDpr1) (Frodo) (Thymus-ex... | 28 | 6.4 | 4 | SYT8_HUMAN (Q8NBV8) Synaptotagmin-8 (Synaptotagmin VIII) (SytVIII) | 28 | 6.4 |
|---|
>DACT1_HUMAN (Q9NYF0) Dapper homolog 1 (hDPR1) (Heptacellular carcinoma novel| gene 3 protein) Length = 836 Score = 31.6 bits (70), Expect = 0.76 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -1 Query: 152 DPCGTRARQSTATSSGIPGMRSTWSASHPWT--RLFGFIIA 36 D CG + T S +P S WSASHP + ++ G+I++ Sbjct: 304 DICGGSELDAVKTDSSLPSPSSLWSASHPSSSKKMDGYILS 344
>AFR_ARATH (Q8LAW2) Protein AFR (Protein ATTENUATED FAR-RED RESPONSE)| Length = 372 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 91 LIPGMPDDVAVDCLARVPHGSYRSMRRVCRGW 186 LI G+P+D+A CL R+P+ + R V W Sbjct: 28 LISGLPNDIAELCLLRLPYPYHALYRSVSSSW 59
>DACT1_MOUSE (Q8R4A3) Dapper homolog 1 (MDpr1) (Frodo) (Thymus-expressed novel| gene 3 protein) Length = 778 Score = 28.5 bits (62), Expect = 6.4 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -1 Query: 152 DPCGTRARQSTATSSGIPGMRSTWSASHPWT--RLFGFIIA 36 D C +T T + +P S WSASHP + ++ G+I++ Sbjct: 260 DICIGSELNATKTDNSLPSPSSLWSASHPASSKKMDGYILS 300
>SYT8_HUMAN (Q8NBV8) Synaptotagmin-8 (Synaptotagmin VIII) (SytVIII)| Length = 172 Score = 28.5 bits (62), Expect = 6.4 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 9/46 (19%) Frame = -1 Query: 119 ATSSGIPGMRSTWSASHPWTR---LFG------FIIACDLCELCCC 9 A ++ IPG+ A PW R + G +++C LC CCC Sbjct: 28 AGTTAIPGLIPDLVAGTPWPRWALIAGALAAGVLLVSCLLCAACCC 73 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,254,937 Number of Sequences: 219361 Number of extensions: 379227 Number of successful extensions: 1483 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1483 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)