| Clone Name | baet72b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous... | 29 | 2.7 | 2 | K1949_PIG (Q767M0) Protein KIAA1949 homolog | 29 | 3.5 | 3 | SYT8_RAT (Q925B4) Synaptotagmin-8 (Synaptotagmin VIII) (SytVIII) | 28 | 7.9 |
|---|
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 29.3 bits (64), Expect = 2.7 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 7/56 (12%) Frame = +1 Query: 13 NHTSELAAEASKQSSCVCE*ASERAQGNH-------PTPAGDDADAHPRRRSRQGG 159 +H S+L+ ++ +S+ + R QG+H PTPAG AD H GG Sbjct: 225 HHGSDLSHHSASEST-----SGHRGQGSHTSPSALSPTPAGVSADEHHNGSGTGGG 275
>K1949_PIG (Q767M0) Protein KIAA1949 homolog| Length = 618 Score = 28.9 bits (63), Expect = 3.5 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +2 Query: 2 PKFETTQVSSQLKQASKARACVSERASE-LRETTLHRPATMPMLIPDDVRAKAEIYTGDA 178 P +Q S + +AS+ R E + L E T+P ++P+D+ E T +A Sbjct: 250 PDSGESQEQSLVLEASEWRLSSGEERKDCLEECGRKEERTLPGMVPEDITGSPETLTMEA 309 Query: 179 AG 184 AG Sbjct: 310 AG 311
>SYT8_RAT (Q925B4) Synaptotagmin-8 (Synaptotagmin VIII) (SytVIII)| Length = 395 Score = 27.7 bits (60), Expect = 7.9 Identities = 25/89 (28%), Positives = 36/89 (40%), Gaps = 17/89 (19%) Frame = +2 Query: 53 ARACVSERASELRETTLHRPATMPM-------LIPDDVRAKAEIYTGDAAGQEKTRLM-- 205 AR VS +A ET +HR PM L+P KA + K +L+ Sbjct: 150 ARVSVSTQAGRRHETKVHRGTLCPMFEETCCFLVPPAELPKATL---------KVQLLDF 200 Query: 206 --------LAETELPSGLLPLKDIIECGY 268 L E +LP G + L+ ++E Y Sbjct: 201 KRFSEHEPLGELQLPLGTVDLQHVLESWY 229 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,979,544 Number of Sequences: 219361 Number of extensions: 437582 Number of successful extensions: 1345 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1345 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)