ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet72b05 |
|---|---|
| Clone Library Name | barley_pub |
>PC11X_GORGO (Q6X862) Protocadherin-11 X-linked precursor (Protocadherin-11)| (Protocadherin on the X chromosome) Length = 1347 Score = 33.1 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 9 PIHLSAFSLVQQPRTSLCHTHLLSVPSTRHHQPP 110 P L S +Q ++LCH+ LS ST+HH PP Sbjct: 1155 PASLDHSSSLQAQASALCHSPPLSQASTQHHSPP 1188
>PC11Y_HUMAN (Q9BZA8) Protocadherin-11 Y-linked precursor (Protocadherin-11)| (Protocadherin-22) (Protocadherin on the Y chromosome) (PCDH-Y) (Protocadherin prostate cancer) (Protocadherin-PC) Length = 1340 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 9 PIHLSAFSLVQQPRTSLCHTHLLSVPSTRHHQPP 110 P L S Q ++LCH+ LS ST+HH PP Sbjct: 1148 PASLDHSSSSQAQASALCHSPPLSQASTQHHSPP 1181
>PC11X_PONPY (Q6WXV7) Protocadherin-11 X-linked precursor (Protocadherin-11)| (Protocadherin on the X chromosome) Length = 1347 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 9 PIHLSAFSLVQQPRTSLCHTHLLSVPSTRHHQPP 110 P L S Q ++LCH+ LS ST+HH PP Sbjct: 1155 PASLDHSSSSQAQASALCHSPPLSQASTQHHSPP 1188
>PC11X_PANTR (Q71M42) Protocadherin-11 X-linked precursor (Protocadherin-11)| (Protocadherin on the X chromosome) Length = 1347 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 9 PIHLSAFSLVQQPRTSLCHTHLLSVPSTRHHQPP 110 P L S Q ++LCH+ LS ST+HH PP Sbjct: 1155 PASLDHSSSSQAQASALCHSPPLSQASTQHHSPP 1188
>PC11X_PANPA (Q6WYY1) Protocadherin-11 X-linked precursor (Protocadherin-11)| (Protocadherin on the X chromosome) Length = 1347 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 9 PIHLSAFSLVQQPRTSLCHTHLLSVPSTRHHQPP 110 P L S Q ++LCH+ LS ST+HH PP Sbjct: 1155 PASLDHSSSSQAQASALCHSPPLSQASTQHHSPP 1188
>PRL_HYPNO (P29235) Prolactin precursor (PRL)| Length = 210 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 15 HLSAFSLVQQPRTSLCHTHLLSVPSTRHH--QPPEEEGKELRR 137 H V PR S+CHT L +P+ + + PE+E L R Sbjct: 54 HFPPVGRVMMPRPSMCHTSSLQIPNDKDQALKVPEDELLSLAR 96
>PRL_CARAU (P87495) Prolactin precursor (PRL)| Length = 210 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 15 HLSAFSLVQQPRTSLCHTHLLSVPSTRHH--QPPEEEGKELRR 137 H V PR S+CHT L +P+ + + PE+E L R Sbjct: 54 HFPPVGRVMMPRPSMCHTSSLQIPNDKDQALKVPEDELLSLAR 96
>LMNB1_HUMAN (P20700) Lamin-B1| Length = 585 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/45 (31%), Positives = 27/45 (60%) Frame = +1 Query: 115 RKARSFAGRLPEQQQQQESAAGCHGEQELAVDARFPIMASRSAAL 249 +++ F +PE+++++E AAG E+EL P ++RS A+ Sbjct: 540 QRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAI 584
>PRL_HYPMO (P35395) Prolactin precursor (PRL) (Fragment)| Length = 207 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 15 HLSAFSLVQQPRTSLCHTHLLSVPSTRHH--QPPEEEGKELRR 137 H V PR S+CHT L +P+ + + PE+E L R Sbjct: 51 HFPPVGRVMMPRPSMCHTSSLQIPNDKDQALKVPEDELLSLAR 93
>PRL_CYPCA (P09585) Prolactin precursor (PRL)| Length = 210 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 15 HLSAFSLVQQPRTSLCHTHLLSVPSTRHH--QPPEEEGKELRR 137 H V PR S+CHT L +P+ + + PE+E L R Sbjct: 54 HFPPVGRVMMPRPSMCHTSSLQIPNDKDQALKIPEDELLSLAR 96
>PC11X_HUMAN (Q9BZA7) Protocadherin-11 X-linked precursor (Protocadherin-11)| (Protocadherin on the X chromosome) (PCDH-X) (Protocadherin-S) Length = 1347 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 9 PIHLSAFSLVQQPRTSLCHTHLLSVPSTRHHQP 107 P L S Q ++LCH+ LS ST+HH P Sbjct: 1155 PASLDHSSSSQAQASALCHSPPLSQASTQHHSP 1187
>AGRN_RAT (P25304) Agrin precursor| Length = 1959 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 135 GEAPCLPPPVAGGAACLAQTASV 67 G+ PCLP P GGA C A A + Sbjct: 1440 GDHPCLPNPCHGGALCQALEAGM 1462
>HNF4G_MOUSE (Q9WUU6) Hepatocyte nuclear factor 4-gamma (HNF-4-gamma)| Length = 408 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 7/48 (14%) Frame = +3 Query: 6 HPIH-------LSAFSLVQQPRTSLCHTHLLSVPSTRHHQPPEEEGKE 128 HP+H L+ +++ P ++L HT ++ P T PP+ G+E Sbjct: 338 HPMHPHLSQDPLTGQTILLGPMSTLVHTDQIATPETPLPSPPQGSGQE 385
>KHSE_RHIME (Q92RG1) Homoserine kinase (EC 2.7.1.39) (HSK) (HK)| Length = 326 Score = 28.9 bits (63), Expect = 3.4 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -1 Query: 227 IIGNLASTASSCSPWHPAADXXXXXXSGSRPAKLLAFLL-RWLVVPRAWHRQQV 69 ++ +LA SC P AD RPA +++FL WL P A H ++V Sbjct: 68 LMHHLAERGLSCPLPLPRADGKLLGTLSGRPAAVISFLEGMWLRKPEAQHCREV 121
>SIF2_DROME (P91620) Protein still life, isoforms C/SIF type 2| Length = 2061 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 85 QARGTTSHRRRKARSFAGRLPEQQQQQESA 174 Q + TSHR+R + +G + E++QQQ +A Sbjct: 217 QDQSKTSHRKRHSLGHSGAVSEEEQQQLTA 246
>KHSE_AGRT5 (Q8UHA8) Homoserine kinase (EC 2.7.1.39) (HSK) (HK)| Length = 322 Score = 28.1 bits (61), Expect = 5.8 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = -1 Query: 257 EKQSAALRDAIIGNLASTASSCSPWHPAADXXXXXXSGSRPAKLLAFLL-RWLVVPRAWH 81 EK ++ +LA+ SC P D RPA L++FL WL P A H Sbjct: 58 EKNDLPFFLGLMQHLAAKGLSCPLPLPRKDGELLGELSGRPAALISFLEGMWLRKPEAKH 117 Query: 80 RQQV 69 ++V Sbjct: 118 CREV 121
>HNF4G_HUMAN (Q14541) Hepatocyte nuclear factor 4-gamma (HNF-4-gamma)| Length = 408 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 7/48 (14%) Frame = +3 Query: 6 HPIH-------LSAFSLVQQPRTSLCHTHLLSVPSTRHHQPPEEEGKE 128 HP+H L+ +++ P ++L H +S P T PP+ G+E Sbjct: 338 HPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQE 385
>NDF2_RAT (Q63689) Neurogenic differentiation factor 2 (NeuroD2) (Brain bHLH| protein KW8) Length = 382 Score = 27.7 bits (60), Expect = 7.6 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = -3 Query: 135 GEAPCLPPPVAG----GAACLAQTASVCDREMYVAAARERKQRGGLGGQ 1 G+AP PPP G G A + S+ E+ E K+ G LGG+ Sbjct: 34 GDAPPQPPPAPGSGAPGPARATKPVSLRGEEVPEPTLAEVKEEGELGGE 82
>NDF2_HUMAN (Q15784) Neurogenic differentiation factor 2 (NeuroD2)| (NeuroD-related factor) (NDRF) Length = 382 Score = 27.7 bits (60), Expect = 7.6 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = -3 Query: 135 GEAPCLPPPVAG----GAACLAQTASVCDREMYVAAARERKQRGGLGGQ 1 G+AP PPP G G A A+ + E A E K+ G LGG+ Sbjct: 34 GDAPPPPPPAPGPGAPGPARAAKPVPLRGEEGTEATLAEVKEEGELGGE 82
>YOR2_NEIGO (O33369) Hypothetical protein (ORF2) (Fragment)| Length = 417 Score = 27.7 bits (60), Expect = 7.6 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 2 CPPNPPLCFLSRAAATYIS-LSHTLAVCAKHAAP 100 C P P + A YIS L HT A C K+AAP Sbjct: 293 CNPALPCSKPATALTGYISALGHTAAKCTKNAAP 326
>SOMA_PANTR (P58756) Somatotropin precursor (Growth hormone) (GH) (GH-N)| (Pituitary growth hormone) (Growth hormone 1) Length = 217 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 27 FSLVQQPRTSLCHTHLLSVPSTRHHQPPEEEGKELR 134 +S +Q P+TSLC + + PS R + + LR Sbjct: 68 YSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLR 103
>SOMA_MACMU (P33093) Somatotropin precursor (Growth hormone) (GH) (GH-N)| (Pituitary growth hormone) (Growth hormone 1) Length = 217 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 27 FSLVQQPRTSLCHTHLLSVPSTRHHQPPEEEGKELR 134 +S +Q P+TSLC + + PS R + + LR Sbjct: 68 YSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLR 103
>SOMA_HUMAN (P01241) Somatotropin precursor (Growth hormone) (GH) (GH-N)| (Pituitary growth hormone) (Growth hormone 1) Length = 217 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 27 FSLVQQPRTSLCHTHLLSVPSTRHHQPPEEEGKELR 134 +S +Q P+TSLC + + PS R + + LR Sbjct: 68 YSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLR 103
>PRL2_ONCTS (Q91364) Prolactin-2 precursor (Prolactin II) (PRL-II)| Length = 210 Score = 27.3 bits (59), Expect = 10.0 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 15 HLSAFSLVQQPRTSLCHTHLLSVPSTR 95 H V PR S+CHT L +P + Sbjct: 54 HFPPMGRVMMPRPSMCHTSSLQIPKDK 80
>PRL2_ONCKE (P09584) Prolactin-2 precursor (Prolactin II) (PRL-II)| Length = 210 Score = 27.3 bits (59), Expect = 10.0 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 15 HLSAFSLVQQPRTSLCHTHLLSVPSTR 95 H V PR S+CHT L +P + Sbjct: 54 HFPPMGRVMMPRPSMCHTSSLQIPKDK 80
>AGRN_HUMAN (O00468) Agrin precursor| Length = 2045 Score = 27.3 bits (59), Expect = 10.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 135 GEAPCLPPPVAGGAAC 88 G+ PCLP P GGA C Sbjct: 1549 GDHPCLPNPCHGGAPC 1564
>TAB2_BRARE (Q5RFW2) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 2 homolog Length = 711 Score = 27.3 bits (59), Expect = 10.0 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +3 Query: 21 SAFSLVQQPRTSLCHTHL---LSVPSTRHHQPPEEEG 122 SA S QP T TH LS+ STR QPP+ G Sbjct: 110 SALSEFYQPETPSVPTHTPASLSMESTRKPQPPQHLG 146
>CYCR_RHOVI (P07173) Photosynthetic reaction center cytochrome c subunit| precursor (Cytochrome c558/c559) Length = 356 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 142 LPEQQQQQESAAGCHGEQELAVDARFPIMASR 237 + E QE CH E LA +A++P + +R Sbjct: 97 ITEWVSPQEGCTYCHDENNLASEAKYPYVVAR 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,067,728 Number of Sequences: 219361 Number of extensions: 586612 Number of successful extensions: 2321 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 2188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2312 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
