| Clone Name | baet72b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VE6_HPV94 (Q705D2) Protein E6 | 32 | 0.43 | 2 | VE6_HPV28 (P50802) Protein E6 | 31 | 0.73 | 3 | VE6_HPV10 (P36802) Protein E6 | 30 | 1.6 | 4 | VE6_HPV03 (P36799) Protein E6 | 30 | 2.1 | 5 | VE6_HPV29 (P50803) Protein E6 | 29 | 3.6 | 6 | PTFAX_XANCP (P45597) Multiphosphoryl transfer protein (MTP) [Inc... | 28 | 6.2 | 7 | H2B1_STRPU (P06145) Histone H2B.1, sperm | 28 | 6.2 |
|---|
>VE6_HPV94 (Q705D2) Protein E6| Length = 148 Score = 32.0 bits (71), Expect = 0.43 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +1 Query: 124 MKTRRGACYSCHEP-AAEEPEMHRRKRRR 207 + T++ CY+CH+P EE + HR +RRR Sbjct: 95 INTQQIRCYTCHKPLVKEEKDRHRNERRR 123
>VE6_HPV28 (P50802) Protein E6| Length = 146 Score = 31.2 bits (69), Expect = 0.73 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 130 TRRGACYSCHEP-AAEEPEMHRRKRRR 207 T++ CY CH+P EE + HR +RRR Sbjct: 95 TQQVRCYMCHKPLVKEEKDRHRNERRR 121
>VE6_HPV10 (P36802) Protein E6| Length = 148 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = +1 Query: 145 CYSCHEP-AAEEPEMHRRKRRR 207 CY CH+P EE + HR +RRR Sbjct: 102 CYMCHKPLVREEKDRHRNERRR 123
>VE6_HPV03 (P36799) Protein E6| Length = 152 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 130 TRRGACYSCHEP-AAEEPEMHRRKRRR 207 T++ CY CH+P EE + HR ++RR Sbjct: 101 TQQIRCYMCHKPLVKEEKDRHRNEKRR 127
>VE6_HPV29 (P50803) Protein E6| Length = 148 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = +1 Query: 145 CYSCHEP-AAEEPEMHRRKRRR 207 CY CH+P EE + HR ++RR Sbjct: 102 CYMCHKPLVREEKDKHRNEKRR 123
>PTFAX_XANCP (P45597) Multiphosphoryl transfer protein (MTP) [Includes:| Phosphoenolpyruvate-protein phosphotransferase (EC 2.7.3.9) (Phosphotransferase system enzyme I); Phosphocarrier protein HPr (Protein H); Fructose-specific phosphotransferase enzyme I Length = 838 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 135 PRLHAACPRSTMRRPCYVVAGGELLQVLDG 46 P H A T+ P V AGG+LL + DG Sbjct: 457 PTSHTAILSRTLGLPALVAAGGQLLDIEDG 486
>H2B1_STRPU (P06145) Histone H2B.1, sperm| Length = 139 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 76 RNDVTRTPHRGTGAGGMKTRRGACYSCHEPAAEEPEMHRRKRRR 207 R+ R+P +G G GG ++RG AA + RR+RRR Sbjct: 9 RSPTKRSPQKGAGKGGKGSKRGGKARRRGGAA----VRRRRRRR 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.130 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,566,201 Number of Sequences: 219361 Number of extensions: 458662 Number of successful extensions: 1445 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1445 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)